| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339830.1 | internal | 247 | 3-743(+) |
Amino Acid sequence : | |||
| TGGHLSSILGVSELTVALHHVFNTPDDKIIWDVGHQAYPHKILTGRRSRMHTIRQTFGLAGFPKRDESPHDAFGAGHSSTSISAGLGMAVGRDLLKKNNHVISVIGDGAMTAGQAYEALN NAGFLDSNLIIVLNDNKQVSLPTATVDGPAPPVGALSKALTRLQASRKFRQLREAAKGMTKQMGNQAHEIASKVDTYVKGMMGKPGASLFEELGIYYIGPVDGHSVEDLVYIFKKVKEMP APGPVLI | |||
Physicochemical properties | |||
| Number of amino acids: | 247 | ||
| Molecular weight: | 26,445.017 | ||
| Theoretical pI: | 9.198 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 35.270 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.147 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.267 | ||
| sheet | 0.251 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339830.1 | internal | 247 | 3-743(+) |
Amino Acid sequence : | |||
| TGGHLSSILGVSELTVALHHVFNTPDDKIIWDVGHQAYPHKILTGRRSRMHTIRQTFGLAGFPKRDESPHDAFGAGHSSTSISAGLGMAVGRDLLKKNNHVISVIGDGAMTAGQAYEALN NAGFLDSNLIIVLNDNKQVSLPTATVDGPAPPVGALSKALTRLQASRKFRQLREAAKGMTKQMGNQAHEIASKVDTYVKGMMGKPGASLFEELGIYYIGPVDGHSVEDLVYIFKKVKEMP APGPVLI | |||
Physicochemical properties | |||
| Number of amino acids: | 247 | ||
| Molecular weight: | 26,445.017 | ||
| Theoretical pI: | 9.198 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 35.270 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.147 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.267 | ||
| sheet | 0.251 | ||