Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339840.1 | 5prime_partial | 147 | 703-260(-) |
Amino Acid sequence : | |||
NTASFKSSQGSQGESDPNNTPIFVGGLDPNVSDAHLRQVFSQYGEVVHVKIPVGKRCGFVQFSDRSCAEQALSNLNGTLLGGQNIRLSWGRSPSNKQTQDQTQWGGGGAYYGYTQGHEVQ GGFAPPQDPNMYYGGYPGYANYQHPHQ* | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 12,047.654 | ||
Theoretical pI: | 6.428 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 33.564 | ||
aromaticity | 0.096 | ||
GRAVY | -0.186 | ||
Secondary Structure Fraction | |||
Helix | 0.346 | ||
turn | 0.192 | ||
sheet | 0.231 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339840.1 | complete | 104 | 376-690(+) |
Amino Acid sequence : | |||
MLHHHPTGSDPESACLKDCDPMRVGYSALLVEYHLSSIKLAQHRTCQKTEQIHIAFQLVFLHVLPRHTGRILVSNGHLIHWGLDHQQILVYYSDHFLPDFPENF* | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 12,047.654 | ||
Theoretical pI: | 6.428 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 33.564 | ||
aromaticity | 0.096 | ||
GRAVY | -0.186 | ||
Secondary Structure Fraction | |||
Helix | 0.346 | ||
turn | 0.192 | ||
sheet | 0.231 |