| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339852.1 | 5prime_partial | 253 | 837-76(-) |
Amino Acid sequence : | |||
| SHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYG GWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVASGMARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKENFDFRPGMISINLDLKRGGNGRFLKTAAYGHFGRDDADFTW EVVKPLKWDKPQA* | |||
Physicochemical properties | |||
| Number of amino acids: | 253 | ||
| Molecular weight: | 13,954.926 | ||
| Theoretical pI: | 9.372 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 41.945 | ||
| aromaticity | 0.008 | ||
| GRAVY | -0.194 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.224 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339852.1 | 3prime_partial | 125 | 463-837(+) |
Amino Acid sequence : | |||
| MSSPATIRVDDDLTTSETSITVRTSNHKPARRVEVENGLLIKVLLRDNRLDHMLLQIRSNLIICHSLVVLCGDQHSVDADRNHRTVLVVVLHGHLSLAVRPQPRARPVFPNLSETGAELR GKNMT | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,954.926 | ||
| Theoretical pI: | 9.372 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 41.945 | ||
| aromaticity | 0.008 | ||
| GRAVY | -0.194 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.224 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339852.1 | 5prime_partial | 253 | 837-76(-) |
Amino Acid sequence : | |||
| SHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYG GWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVASGMARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKENFDFRPGMISINLDLKRGGNGRFLKTAAYGHFGRDDADFTW EVVKPLKWDKPQA* | |||
Physicochemical properties | |||
| Number of amino acids: | 253 | ||
| Molecular weight: | 13,954.926 | ||
| Theoretical pI: | 9.372 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 41.945 | ||
| aromaticity | 0.008 | ||
| GRAVY | -0.194 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.224 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339852.1 | 3prime_partial | 125 | 463-837(+) |
Amino Acid sequence : | |||
| MSSPATIRVDDDLTTSETSITVRTSNHKPARRVEVENGLLIKVLLRDNRLDHMLLQIRSNLIICHSLVVLCGDQHSVDADRNHRTVLVVVLHGHLSLAVRPQPRARPVFPNLSETGAELR GKNMT | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,954.926 | ||
| Theoretical pI: | 9.372 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 41.945 | ||
| aromaticity | 0.008 | ||
| GRAVY | -0.194 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.224 | ||
| sheet | 0.248 | ||