| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339854.1 | complete | 181 | 135-680(+) |
Amino Acid sequence : | |||
| MKERPHITITSPIDTYHTHRQISDSQEYVKDTCTHILKSKPHMKSMLNYSSNSSKPTQCDSQGDNGRLAQSLASPSTPEKPNASGSTLPCPCGTPPQPQPLTHRPPREKRRRPPSSQSCG SKTQHTHTPAGGKPPPACRSASSTPFQYGTLSYPDYPLLSTLLQRCSLFSTWRNRPWTPEK* | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 17,370.465 | ||
| Theoretical pI: | 5.886 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
| Instability index: | 43.519 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.458 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.186 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339854.1 | 5prime_partial | 156 | 756-286(-) |
Amino Acid sequence : | |||
| DEAEAMKKTIQECEEKGIKGEEKVCATSLESMVDFATSKIGNNVEAVSTEADSPDRKVYRIERVSRKPSDKPVVVCHQQEYEYAVFYCHKTETTVAYDVSLVGAGGSKAEAVAVCHRDTA EWNPKHLAFQVLKVKPGTVPVCHYLPENHIVWVSKN* | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 17,370.465 | ||
| Theoretical pI: | 5.886 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20315 | ||
| Instability index: | 43.519 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.458 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.186 | ||
| sheet | 0.244 | ||