| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339870.1 | 5prime_partial | 197 | 771-178(-) |
Amino Acid sequence : | |||
| EKIRDKLCCKGAKVIKSIEIKEPPPKPKDPPKPKDPEKPKTEEPKPPEKPKVTFVEPPKDPKPQPPPKEKPPPQPAPAEKPPPQEKPQPPPKEKPPEKPKDVPKPAPPPAPIPVPVPTPP PAEPVPACWAPPVRTCCGPCSEGYGGGPCYFGYGVAPPPPQPHYEGYCGYGYHERPCHVTRCDYYFSEENPQACSIM* | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 16,408.727 | ||
| Theoretical pI: | 6.114 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 55000 55000 | ||
| Instability index: | 62.559 | ||
| aromaticity | 0.122 | ||
| GRAVY | 0.496 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.231 | ||
| sheet | 0.468 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339870.1 | complete | 156 | 243-713(+) |
Amino Acid sequence : | |||
| MAFHGIHTRSSPHSAAAAAAAPPHTQSNMALHHNPLSMAHNMSSPVAPSTQALAPPEAALAPGLESAPAAVPVLERPWAFPAAFLWAGAVAFPEAAAFLPVLAAAAAFLWVEAAAWGPLV AQRRLLWAFLAAWVLQFWAFQGLWAWGGLWALEEAP* | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 16,408.727 | ||
| Theoretical pI: | 6.114 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 55000 55000 | ||
| Instability index: | 62.559 | ||
| aromaticity | 0.122 | ||
| GRAVY | 0.496 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.231 | ||
| sheet | 0.468 | ||