Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339881.1 | 5prime_partial | 154 | 3-467(+) |
Amino Acid sequence : | |||
PEVANDAPIQTARTVQKEAPPSAKVMVAGNDVPSTGVEFVQRASMVGPSFALHMGAVKDVLLQSAQKALGDAPNSVFDTVVERDVNSTGVGKVLREALISAKLMVEGRHARGVTQVTSLG KTIFHATHLPGVKLGSASHMGPWSRIKGFMVVQL* | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 10,702.838 | ||
Theoretical pI: | 4.050 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 40.147 | ||
aromaticity | 0.125 | ||
GRAVY | 0.355 | ||
Secondary Structure Fraction | |||
Helix | 0.240 | ||
turn | 0.327 | ||
sheet | 0.279 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339881.1 | 3prime_partial | 104 | 313-2(-) |
Amino Acid sequence : | |||
MSFAEISASLSTFPTPVEFTSLSTTVSNTEFGASPSAFCALWSSTSFTAPMCNAKEGPTMDALWTNSTPVEGTSFPATMTFAEGGASFCTVLAVWIGASFATSG | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 10,702.838 | ||
Theoretical pI: | 4.050 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 40.147 | ||
aromaticity | 0.125 | ||
GRAVY | 0.355 | ||
Secondary Structure Fraction | |||
Helix | 0.240 | ||
turn | 0.327 | ||
sheet | 0.279 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339881.1 | 5prime_partial | 154 | 3-467(+) |
Amino Acid sequence : | |||
PEVANDAPIQTARTVQKEAPPSAKVMVAGNDVPSTGVEFVQRASMVGPSFALHMGAVKDVLLQSAQKALGDAPNSVFDTVVERDVNSTGVGKVLREALISAKLMVEGRHARGVTQVTSLG KTIFHATHLPGVKLGSASHMGPWSRIKGFMVVQL* | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 10,702.838 | ||
Theoretical pI: | 4.050 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 40.147 | ||
aromaticity | 0.125 | ||
GRAVY | 0.355 | ||
Secondary Structure Fraction | |||
Helix | 0.240 | ||
turn | 0.327 | ||
sheet | 0.279 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339881.1 | 3prime_partial | 104 | 313-2(-) |
Amino Acid sequence : | |||
MSFAEISASLSTFPTPVEFTSLSTTVSNTEFGASPSAFCALWSSTSFTAPMCNAKEGPTMDALWTNSTPVEGTSFPATMTFAEGGASFCTVLAVWIGASFATSG | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 10,702.838 | ||
Theoretical pI: | 4.050 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
Instability index: | 40.147 | ||
aromaticity | 0.125 | ||
GRAVY | 0.355 | ||
Secondary Structure Fraction | |||
Helix | 0.240 | ||
turn | 0.327 | ||
sheet | 0.279 |