Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339885.1 | 5prime_partial | 142 | 588-160(-) |
Amino Acid sequence : | |||
TRPRADSARGLIITFFHISKFNCDMTSSIKFMCTVLIAAALMAAVAPPCEAAVGCGAVVSYLNPCIPYVTGKGPLGGCCGGVKGLNGAAKTTADRQSVCTCLKGLVGKYKGVDLGKAARL PGQCGVKLPYKISPSTDCKSVK* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 12,017.738 | ||
Theoretical pI: | 9.358 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 53.748 | ||
aromaticity | 0.110 | ||
GRAVY | -0.171 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.330 | ||
sheet | 0.202 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339885.1 | complete | 109 | 59-388(+) |
Amino Acid sequence : | |||
MEKNPLDFKPKGPKSQPSFYSFSNTMEVVGIILAHFTDLQSVEGLILYGSLTPHWPGSLAALPRSTPLYLPTRPFRQVQTDCRSAVVFAAPLRPFTPPQHPPSGPFPVT* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 12,017.738 | ||
Theoretical pI: | 9.358 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 53.748 | ||
aromaticity | 0.110 | ||
GRAVY | -0.171 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.330 | ||
sheet | 0.202 |