Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339912.1 | 5prime_partial | 165 | 690-193(-) |
Amino Acid sequence : | |||
VRRGARIYAEFLGGAVNSDAHHMTDPRADGLGVSSCIMKSLEDARVAPEEVNYVNAHATSTPAGDLAEVNAINKVFKNSSELKMNGTKFMIGHGLGAAGGLEAIATIKAITSGWLHPPLN QDELEGSVIIDTVPNVRKQHQVNVAIWNSFGFGGHNSVVVLAPFP* | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 17,468.560 | ||
Theoretical pI: | 6.151 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 33.883 | ||
aromaticity | 0.061 | ||
GRAVY | -0.047 | ||
Secondary Structure Fraction | |||
Helix | 0.285 | ||
turn | 0.291 | ||
sheet | 0.261 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339912.1 | 5prime_partial | 165 | 690-193(-) |
Amino Acid sequence : | |||
VRRGARIYAEFLGGAVNSDAHHMTDPRADGLGVSSCIMKSLEDARVAPEEVNYVNAHATSTPAGDLAEVNAINKVFKNSSELKMNGTKFMIGHGLGAAGGLEAIATIKAITSGWLHPPLN QDELEGSVIIDTVPNVRKQHQVNVAIWNSFGFGGHNSVVVLAPFP* | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 17,468.560 | ||
Theoretical pI: | 6.151 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 33.883 | ||
aromaticity | 0.061 | ||
GRAVY | -0.047 | ||
Secondary Structure Fraction | |||
Helix | 0.285 | ||
turn | 0.291 | ||
sheet | 0.261 |