| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339924.1 | complete | 217 | 55-708(+) |
Amino Acid sequence : | |||
| MVRFIRQDVEEKANEISVSAEEEFNIEKLQLVEAEKKKIRQEYERKEKQVQVRKKIEYSMQLNASRIKVLQAQDDLVNSMKDAASKELLVVSSNHSNYRNLLKNLVVQSLLRLKEPSVLL RCRKEDLQLVESVLDSAKEEYSQKAKVHPPEIIVDQIYLPPAPSHQDAHGVFCSGGVVLASRDGKIVFENTLDARLDVLFHKKLPEIRKSLFGQIAA* | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 24,847.341 | ||
| Theoretical pI: | 8.397 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 48.112 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.439 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.180 | ||
| sheet | 0.300 | ||