| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339925.1 | 5prime_partial | 232 | 762-64(-) |
Amino Acid sequence : | |||
| KLVLPDGTILRCQHYALPTRDCLFENPLFDGKTLLKLWNLNKFGGVIGIFNCQGAGWYPEEHKCKAHPECYKTMSGSLSPNDVEWEQESFTADFRNNGIFAVYLHKAGNLRLMKATEKLD ITLEPSAYEIAMISPVMECGNGMQFAVVGLENMFNSGGSVELVEQKYEEKNVDYLVKIKGAGKFLAYSSVKPEKVVLGDESVEFEWRNDGVLKFEVPWNDGQHKDVHILITE* | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 26,188.642 | ||
| Theoretical pI: | 5.245 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39420 39795 | ||
| Instability index: | 40.543 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.280 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.237 | ||
| sheet | 0.272 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339925.1 | 5prime_partial | 232 | 762-64(-) |
Amino Acid sequence : | |||
| KLVLPDGTILRCQHYALPTRDCLFENPLFDGKTLLKLWNLNKFGGVIGIFNCQGAGWYPEEHKCKAHPECYKTMSGSLSPNDVEWEQESFTADFRNNGIFAVYLHKAGNLRLMKATEKLD ITLEPSAYEIAMISPVMECGNGMQFAVVGLENMFNSGGSVELVEQKYEEKNVDYLVKIKGAGKFLAYSSVKPEKVVLGDESVEFEWRNDGVLKFEVPWNDGQHKDVHILITE* | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 26,188.642 | ||
| Theoretical pI: | 5.245 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39420 39795 | ||
| Instability index: | 40.543 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.280 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.237 | ||
| sheet | 0.272 | ||