| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339928.1 | 5prime_partial | 269 | 839-30(-) |
Amino Acid sequence : | |||
| AQTPLSRLLLQQGDESMAAYFLLQNSPVLLDGWVKXSSRTLTNQTPDSSDEFWEYASKNPTFSKVFNEAMACHARQAVSQILGGCPEVFEGIGSLVDVGGGDGTAIRSIVKGCPWIRGIN FDLPHVASAAPPLHGVQHVGGDMFKEVPKADAVFIMWVLHDWGDEECIEILKKCKEAVPKETGKVIIAEAVIGEGEGDKYINGIRLSLDMVMLAHTDTGRERTIEEWKYVLNGTGFSSYT VKDIDSIISIIEAHQGLCLSCYQNYVLKR* | |||
Physicochemical properties | |||
| Number of amino acids: | 269 | ||
| Molecular weight: | 17,941.272 | ||
| Theoretical pI: | 10.755 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 61.803 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.485 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.239 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339928.1 | 3prime_partial | 160 | 360-839(+) |
Amino Acid sequence : | |||
| MQHPHDENSVSLGNLFEHVPSYMLNAVEGRRCRRNVREIEINPANPGATLHDGAYSRAIAAANIHQTTNPLKNLWTTTQDLRHGLPSVARHGLVEHFAERWILRRVFPKLIGGVGSLIGE GARAXLHPPIQQHRAVLQQKIRRHAFISLLEEQTRKRSLG | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 17,941.272 | ||
| Theoretical pI: | 10.755 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 61.803 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.485 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.239 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339928.1 | 5prime_partial | 269 | 839-30(-) |
Amino Acid sequence : | |||
| AQTPLSRLLLQQGDESMAAYFLLQNSPVLLDGWVKXSSRTLTNQTPDSSDEFWEYASKNPTFSKVFNEAMACHARQAVSQILGGCPEVFEGIGSLVDVGGGDGTAIRSIVKGCPWIRGIN FDLPHVASAAPPLHGVQHVGGDMFKEVPKADAVFIMWVLHDWGDEECIEILKKCKEAVPKETGKVIIAEAVIGEGEGDKYINGIRLSLDMVMLAHTDTGRERTIEEWKYVLNGTGFSSYT VKDIDSIISIIEAHQGLCLSCYQNYVLKR* | |||
Physicochemical properties | |||
| Number of amino acids: | 269 | ||
| Molecular weight: | 17,941.272 | ||
| Theoretical pI: | 10.755 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 61.803 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.485 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.239 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339928.1 | 3prime_partial | 160 | 360-839(+) |
Amino Acid sequence : | |||
| MQHPHDENSVSLGNLFEHVPSYMLNAVEGRRCRRNVREIEINPANPGATLHDGAYSRAIAAANIHQTTNPLKNLWTTTQDLRHGLPSVARHGLVEHFAERWILRRVFPKLIGGVGSLIGE GARAXLHPPIQQHRAVLQQKIRRHAFISLLEEQTRKRSLG | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 17,941.272 | ||
| Theoretical pI: | 10.755 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 61.803 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.485 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.239 | ||
| sheet | 0.270 | ||