| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339946.1 | 5prime_partial | 134 | 636-232(-) |
Amino Acid sequence : | |||
| RSTTETSTVGTRKAIPVNFPFKSRERFANSLGSSGATWDNIERCSSSAPPVLGRWSINSLLSCSNRVDCCHKTFDNTKPIIDNLSQWGKAVCGTTSIGHNIQVRCVCLSLTPTTNMGASL LGAEMMTFFAPPFR* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 11,176.584 | ||
| Theoretical pI: | 8.018 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 11.038 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.522 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.200 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339946.1 | complete | 100 | 32-334(+) |
Amino Acid sequence : | |||
| MFKYDSVHGQWKHHELKVKDDKTLLFGEKSVTVFGIRNPEEIPWGETGAEYIVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNERHTHRT* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,176.584 | ||
| Theoretical pI: | 8.018 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 11.038 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.522 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.200 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339946.1 | 5prime_partial | 134 | 636-232(-) |
Amino Acid sequence : | |||
| RSTTETSTVGTRKAIPVNFPFKSRERFANSLGSSGATWDNIERCSSSAPPVLGRWSINSLLSCSNRVDCCHKTFDNTKPIIDNLSQWGKAVCGTTSIGHNIQVRCVCLSLTPTTNMGASL LGAEMMTFFAPPFR* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 11,176.584 | ||
| Theoretical pI: | 8.018 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 11.038 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.522 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.200 | ||
| sheet | 0.210 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339946.1 | complete | 100 | 32-334(+) |
Amino Acid sequence : | |||
| MFKYDSVHGQWKHHELKVKDDKTLLFGEKSVTVFGIRNPEEIPWGETGAEYIVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNERHTHRT* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,176.584 | ||
| Theoretical pI: | 8.018 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 11.038 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.522 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.200 | ||
| sheet | 0.210 | ||