| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339949.1 | internal | 191 | 1-573(+) |
Amino Acid sequence : | |||
| YDKTPTGRIHKGVCSTWMKNAVPLEESPNCSSAPIFVRTSNFRLPTDPKAPVIMIGPGTGLAPFRGFLQERLALKESGVELGPAILFFGCRNSKMDFIYQDELNKFVEAGVVSELILAFS REGPVKEYVQHKMAQKASDVWNMISEGGYVYVCGDAKGMARDVHRTLHTIVQEQGSLDNSKTESFVKNLQM | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 21,190.118 | ||
| Theoretical pI: | 7.834 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 46.395 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.241 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.257 | ||
| sheet | 0.241 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339949.1 | internal | 191 | 1-573(+) |
Amino Acid sequence : | |||
| YDKTPTGRIHKGVCSTWMKNAVPLEESPNCSSAPIFVRTSNFRLPTDPKAPVIMIGPGTGLAPFRGFLQERLALKESGVELGPAILFFGCRNSKMDFIYQDELNKFVEAGVVSELILAFS REGPVKEYVQHKMAQKASDVWNMISEGGYVYVCGDAKGMARDVHRTLHTIVQEQGSLDNSKTESFVKNLQM | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 21,190.118 | ||
| Theoretical pI: | 7.834 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 46.395 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.241 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.257 | ||
| sheet | 0.241 | ||