Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339954.1	internal	226	1-678(+)
Amino Acid sequence :
RYKMGRQALRVTPNMLCVRAAVRSNTLALHSPPPSIRRKSRLPFSIRMSSSAAPNQIIEHIVLFKAKPDAEPSAVNAMLRNLNALSSLDSVLHISAGPVARCRSSALTFTHMLHSRYRSK SDLASYTDDPTHVGVVTNYVKPVVDDVMAVDWVADDFSGAAEVPPGAALRLTVLKLKEEAGESGKSEVLAAVRGIKDKFGSIEQLTVGENFSPGRAKGFSIASIAV
Physicochemical properties
Number of amino acids:		226
Molecular weight:		12,628.521
Theoretical pI:		10.586
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		23490 23615
Instability index:		64.318
aromaticity		0.054
GRAVY		-0.395
Secondary Structure Fraction
Helix		0.234
turn		0.171
sheet		0.396

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339954.1	5prime_partial	163	678-187(-)
Amino Acid sequence :
NRYRCDRKPFRPPRREVLPHRQLLNRPEFILNPSHRRQHLTLPALPRLLLQLQHGQPQRCSGRHLRGTGEIVGDPIDGHDVVHDGLDVVGDDADVGGIVGVGGEVGFGSVAGVEHVGEGE GGGAAAGDGAGGDVEDGIEGGEGVEVAEHGVDGGGLGVGLGFE*
Physicochemical properties
Number of amino acids:		163
Molecular weight:		12,628.521
Theoretical pI:		10.586
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		23490 23615
Instability index:		64.318
aromaticity		0.054
GRAVY		-0.395
Secondary Structure Fraction
Helix		0.234
turn		0.171
sheet		0.396

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339954.1	3prime_partial	111	335-3(-)
Amino Acid sequence :
MWVKVRAEERQRATGPAEMWRTESREERALRLRSMALTAEGSASGLALNRTMCSMIWLGAAEEDILMEKGRRDLRRIDGGGEWRARVLLRTAALTQSMFGVTRSACRPILY
Physicochemical properties
Number of amino acids:		111
Molecular weight:		12,628.521
Theoretical pI:		10.586
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		23490 23615
Instability index:		64.318
aromaticity		0.054
GRAVY		-0.395
Secondary Structure Fraction
Helix		0.234
turn		0.171
sheet		0.396

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339954.1	internal	226	1-678(+)
Amino Acid sequence :
RYKMGRQALRVTPNMLCVRAAVRSNTLALHSPPPSIRRKSRLPFSIRMSSSAAPNQIIEHIVLFKAKPDAEPSAVNAMLRNLNALSSLDSVLHISAGPVARCRSSALTFTHMLHSRYRSK SDLASYTDDPTHVGVVTNYVKPVVDDVMAVDWVADDFSGAAEVPPGAALRLTVLKLKEEAGESGKSEVLAAVRGIKDKFGSIEQLTVGENFSPGRAKGFSIASIAV
Physicochemical properties
Number of amino acids:		226
Molecular weight:		12,628.521
Theoretical pI:		10.586
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		23490 23615
Instability index:		64.318
aromaticity		0.054
GRAVY		-0.395
Secondary Structure Fraction
Helix		0.234
turn		0.171
sheet		0.396

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339954.1	5prime_partial	163	678-187(-)
Amino Acid sequence :
NRYRCDRKPFRPPRREVLPHRQLLNRPEFILNPSHRRQHLTLPALPRLLLQLQHGQPQRCSGRHLRGTGEIVGDPIDGHDVVHDGLDVVGDDADVGGIVGVGGEVGFGSVAGVEHVGEGE GGGAAAGDGAGGDVEDGIEGGEGVEVAEHGVDGGGLGVGLGFE*
Physicochemical properties
Number of amino acids:		163
Molecular weight:		12,628.521
Theoretical pI:		10.586
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		23490 23615
Instability index:		64.318
aromaticity		0.054
GRAVY		-0.395
Secondary Structure Fraction
Helix		0.234
turn		0.171
sheet		0.396

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339954.1	3prime_partial	111	335-3(-)
Amino Acid sequence :
MWVKVRAEERQRATGPAEMWRTESREERALRLRSMALTAEGSASGLALNRTMCSMIWLGAAEEDILMEKGRRDLRRIDGGGEWRARVLLRTAALTQSMFGVTRSACRPILY
Physicochemical properties
Number of amino acids:		111
Molecular weight:		12,628.521
Theoretical pI:		10.586
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		23490 23615
Instability index:		64.318
aromaticity		0.054
GRAVY		-0.395
Secondary Structure Fraction
Helix		0.234
turn		0.171
sheet		0.396