Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339963.1 | internal | 166 | 1-498(+) |
Amino Acid sequence : | |||
DVCSRNREHFLDNLITERRNLRIEGLDGLLLLILQAGERLLQLGLDLLPALRQLLLHLHLRLLLHLVERRRDLRPGRLHDRRSLLLQLLHLRRGVLDAVELLPDGGVSLVHELPERAVVK LVHGEHEEQELDGDDGESEVEVEEGGLLDLDGEGGRRVGEGEGGGG | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 15,731.802 | ||
Theoretical pI: | 8.335 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 74.637 | ||
aromaticity | 0.007 | ||
GRAVY | -1.284 | ||
Secondary Structure Fraction | |||
Helix | 0.107 | ||
turn | 0.313 | ||
sheet | 0.280 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339963.1 | 5prime_partial | 162 | 498-10(-) |
Amino Acid sequence : | |||
AATTFSLSHAPPSLAVEIEKAALFDFNLTLPIIAVEFLLLMFAMDKLYYSPLGKFMDERDAAIREKLNSVKDTSTEVKQLEEQGSAVMKAARAEISAALNKMKKETQVEVEQKLAEGRKK IEAELQEALASLENQKEETIKALDSQIAALSDEIVKKVLPVP* | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 15,731.802 | ||
Theoretical pI: | 8.335 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 74.637 | ||
aromaticity | 0.007 | ||
GRAVY | -1.284 | ||
Secondary Structure Fraction | |||
Helix | 0.107 | ||
turn | 0.313 | ||
sheet | 0.280 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339963.1 | 5prime_partial | 150 | 496-44(-) |
Amino Acid sequence : | |||
RHHLLPLPRAALPRRRDREGRPLRLQPHSPHHRRRVPAPHVRHGQALLQPAREVHGRERRRHQGEAQQRQGHLDGGEAAGGAGIGGHEGGQGGDLGGAQQDEEGDAGGGGAEAGGGPEED RGRAAGGARQLGESEGGDHQGPRFADCGAQ* | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 15,731.802 | ||
Theoretical pI: | 8.335 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 74.637 | ||
aromaticity | 0.007 | ||
GRAVY | -1.284 | ||
Secondary Structure Fraction | |||
Helix | 0.107 | ||
turn | 0.313 | ||
sheet | 0.280 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339963.1 | internal | 166 | 1-498(+) |
Amino Acid sequence : | |||
DVCSRNREHFLDNLITERRNLRIEGLDGLLLLILQAGERLLQLGLDLLPALRQLLLHLHLRLLLHLVERRRDLRPGRLHDRRSLLLQLLHLRRGVLDAVELLPDGGVSLVHELPERAVVK LVHGEHEEQELDGDDGESEVEVEEGGLLDLDGEGGRRVGEGEGGGG | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 15,731.802 | ||
Theoretical pI: | 8.335 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 74.637 | ||
aromaticity | 0.007 | ||
GRAVY | -1.284 | ||
Secondary Structure Fraction | |||
Helix | 0.107 | ||
turn | 0.313 | ||
sheet | 0.280 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339963.1 | 5prime_partial | 162 | 498-10(-) |
Amino Acid sequence : | |||
AATTFSLSHAPPSLAVEIEKAALFDFNLTLPIIAVEFLLLMFAMDKLYYSPLGKFMDERDAAIREKLNSVKDTSTEVKQLEEQGSAVMKAARAEISAALNKMKKETQVEVEQKLAEGRKK IEAELQEALASLENQKEETIKALDSQIAALSDEIVKKVLPVP* | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 15,731.802 | ||
Theoretical pI: | 8.335 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 74.637 | ||
aromaticity | 0.007 | ||
GRAVY | -1.284 | ||
Secondary Structure Fraction | |||
Helix | 0.107 | ||
turn | 0.313 | ||
sheet | 0.280 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339963.1 | 5prime_partial | 150 | 496-44(-) |
Amino Acid sequence : | |||
RHHLLPLPRAALPRRRDREGRPLRLQPHSPHHRRRVPAPHVRHGQALLQPAREVHGRERRRHQGEAQQRQGHLDGGEAAGGAGIGGHEGGQGGDLGGAQQDEEGDAGGGGAEAGGGPEED RGRAAGGARQLGESEGGDHQGPRFADCGAQ* | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 15,731.802 | ||
Theoretical pI: | 8.335 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 74.637 | ||
aromaticity | 0.007 | ||
GRAVY | -1.284 | ||
Secondary Structure Fraction | |||
Helix | 0.107 | ||
turn | 0.313 | ||
sheet | 0.280 |