| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339963.1 | internal | 166 | 1-498(+) |
Amino Acid sequence : | |||
| DVCSRNREHFLDNLITERRNLRIEGLDGLLLLILQAGERLLQLGLDLLPALRQLLLHLHLRLLLHLVERRRDLRPGRLHDRRSLLLQLLHLRRGVLDAVELLPDGGVSLVHELPERAVVK LVHGEHEEQELDGDDGESEVEVEEGGLLDLDGEGGRRVGEGEGGGG | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 15,731.802 | ||
| Theoretical pI: | 8.335 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 74.637 | ||
| aromaticity | 0.007 | ||
| GRAVY | -1.284 | ||
Secondary Structure Fraction | |||
| Helix | 0.107 | ||
| turn | 0.313 | ||
| sheet | 0.280 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339963.1 | 5prime_partial | 162 | 498-10(-) |
Amino Acid sequence : | |||
| AATTFSLSHAPPSLAVEIEKAALFDFNLTLPIIAVEFLLLMFAMDKLYYSPLGKFMDERDAAIREKLNSVKDTSTEVKQLEEQGSAVMKAARAEISAALNKMKKETQVEVEQKLAEGRKK IEAELQEALASLENQKEETIKALDSQIAALSDEIVKKVLPVP* | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 15,731.802 | ||
| Theoretical pI: | 8.335 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 74.637 | ||
| aromaticity | 0.007 | ||
| GRAVY | -1.284 | ||
Secondary Structure Fraction | |||
| Helix | 0.107 | ||
| turn | 0.313 | ||
| sheet | 0.280 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339963.1 | 5prime_partial | 150 | 496-44(-) |
Amino Acid sequence : | |||
| RHHLLPLPRAALPRRRDREGRPLRLQPHSPHHRRRVPAPHVRHGQALLQPAREVHGRERRRHQGEAQQRQGHLDGGEAAGGAGIGGHEGGQGGDLGGAQQDEEGDAGGGGAEAGGGPEED RGRAAGGARQLGESEGGDHQGPRFADCGAQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 15,731.802 | ||
| Theoretical pI: | 8.335 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 74.637 | ||
| aromaticity | 0.007 | ||
| GRAVY | -1.284 | ||
Secondary Structure Fraction | |||
| Helix | 0.107 | ||
| turn | 0.313 | ||
| sheet | 0.280 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339963.1 | internal | 166 | 1-498(+) |
Amino Acid sequence : | |||
| DVCSRNREHFLDNLITERRNLRIEGLDGLLLLILQAGERLLQLGLDLLPALRQLLLHLHLRLLLHLVERRRDLRPGRLHDRRSLLLQLLHLRRGVLDAVELLPDGGVSLVHELPERAVVK LVHGEHEEQELDGDDGESEVEVEEGGLLDLDGEGGRRVGEGEGGGG | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 15,731.802 | ||
| Theoretical pI: | 8.335 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 74.637 | ||
| aromaticity | 0.007 | ||
| GRAVY | -1.284 | ||
Secondary Structure Fraction | |||
| Helix | 0.107 | ||
| turn | 0.313 | ||
| sheet | 0.280 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339963.1 | 5prime_partial | 162 | 498-10(-) |
Amino Acid sequence : | |||
| AATTFSLSHAPPSLAVEIEKAALFDFNLTLPIIAVEFLLLMFAMDKLYYSPLGKFMDERDAAIREKLNSVKDTSTEVKQLEEQGSAVMKAARAEISAALNKMKKETQVEVEQKLAEGRKK IEAELQEALASLENQKEETIKALDSQIAALSDEIVKKVLPVP* | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 15,731.802 | ||
| Theoretical pI: | 8.335 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 74.637 | ||
| aromaticity | 0.007 | ||
| GRAVY | -1.284 | ||
Secondary Structure Fraction | |||
| Helix | 0.107 | ||
| turn | 0.313 | ||
| sheet | 0.280 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339963.1 | 5prime_partial | 150 | 496-44(-) |
Amino Acid sequence : | |||
| RHHLLPLPRAALPRRRDREGRPLRLQPHSPHHRRRVPAPHVRHGQALLQPAREVHGRERRRHQGEAQQRQGHLDGGEAAGGAGIGGHEGGQGGDLGGAQQDEEGDAGGGGAEAGGGPEED RGRAAGGARQLGESEGGDHQGPRFADCGAQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 15,731.802 | ||
| Theoretical pI: | 8.335 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 74.637 | ||
| aromaticity | 0.007 | ||
| GRAVY | -1.284 | ||
Secondary Structure Fraction | |||
| Helix | 0.107 | ||
| turn | 0.313 | ||
| sheet | 0.280 | ||