| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339979.1 | internal | 130 | 2-391(+) |
Amino Acid sequence : | |||
| CLYQVSYGDGSYTVGNFSTETISFGNSGSVPNVAIGCGHHNEGLFAGAAGLLGLGGGSLSLPSQIKATSFSYCLVNRDSTSSTTLEFNSARPSDSVLAPLLKNSLIDTYHYIGLTGINVG GHAVQFSPSL | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 13,353.661 | ||
| Theoretical pI: | 5.648 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 32.387 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.142 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.392 | ||
| sheet | 0.200 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339979.1 | internal | 130 | 2-391(+) |
Amino Acid sequence : | |||
| CLYQVSYGDGSYTVGNFSTETISFGNSGSVPNVAIGCGHHNEGLFAGAAGLLGLGGGSLSLPSQIKATSFSYCLVNRDSTSSTTLEFNSARPSDSVLAPLLKNSLIDTYHYIGLTGINVG GHAVQFSPSL | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 13,353.661 | ||
| Theoretical pI: | 5.648 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 32.387 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.142 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.392 | ||
| sheet | 0.200 | ||