| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339984.1 | internal | 227 | 1-681(+) |
Amino Acid sequence : | |||
| EMQXHGDGPWMGPGQNGFSSVPERAAYVQREDLMPRYMPDRFIAPPTFDQSHPQERNITYGNRDVRNTDRAFDGSLPASPSPRGGPPSITDDVSSDNVWPEEKMRDKSVAAIKEFYSARD EKEVALCIKDLNAPRFYPSMISIWITDSFERKDMERDLLSKLLINLTKPQDAMISEDQLIKGFENVLAVLEDAVNDAPRAAEFLGRIFAKIILENAVSLSDVGRLIY | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 14,994.190 | ||
| Theoretical pI: | 9.300 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12865 | ||
| Instability index: | 44.133 | ||
| aromaticity | 0.039 | ||
| GRAVY | 0.223 | ||
Secondary Structure Fraction | |||
| Helix | 0.349 | ||
| turn | 0.163 | ||
| sheet | 0.349 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339984.1 | 5prime_partial | 130 | 2-394(+) |
Amino Acid sequence : | |||
| RCKXMEMDRGWDLARMASAPYLKEQLMFKERILCQGICLTGSLRPQLLINLIPRNGILPTGIEMLEIQIVLLMDLCPLHLLLEVDHLVLPMMFLQIMCGRKRKCVISQWLQSKNSTVQEM RRKLLCASRI* | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 14,994.190 | ||
| Theoretical pI: | 9.300 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12865 | ||
| Instability index: | 44.133 | ||
| aromaticity | 0.039 | ||
| GRAVY | 0.223 | ||
Secondary Structure Fraction | |||
| Helix | 0.349 | ||
| turn | 0.163 | ||
| sheet | 0.349 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339984.1 | internal | 227 | 1-681(+) |
Amino Acid sequence : | |||
| EMQXHGDGPWMGPGQNGFSSVPERAAYVQREDLMPRYMPDRFIAPPTFDQSHPQERNITYGNRDVRNTDRAFDGSLPASPSPRGGPPSITDDVSSDNVWPEEKMRDKSVAAIKEFYSARD EKEVALCIKDLNAPRFYPSMISIWITDSFERKDMERDLLSKLLINLTKPQDAMISEDQLIKGFENVLAVLEDAVNDAPRAAEFLGRIFAKIILENAVSLSDVGRLIY | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 14,994.190 | ||
| Theoretical pI: | 9.300 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12865 | ||
| Instability index: | 44.133 | ||
| aromaticity | 0.039 | ||
| GRAVY | 0.223 | ||
Secondary Structure Fraction | |||
| Helix | 0.349 | ||
| turn | 0.163 | ||
| sheet | 0.349 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339984.1 | 5prime_partial | 130 | 2-394(+) |
Amino Acid sequence : | |||
| RCKXMEMDRGWDLARMASAPYLKEQLMFKERILCQGICLTGSLRPQLLINLIPRNGILPTGIEMLEIQIVLLMDLCPLHLLLEVDHLVLPMMFLQIMCGRKRKCVISQWLQSKNSTVQEM RRKLLCASRI* | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 14,994.190 | ||
| Theoretical pI: | 9.300 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12865 | ||
| Instability index: | 44.133 | ||
| aromaticity | 0.039 | ||
| GRAVY | 0.223 | ||
Secondary Structure Fraction | |||
| Helix | 0.349 | ||
| turn | 0.163 | ||
| sheet | 0.349 | ||