| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339987.1 | 5prime_partial | 197 | 3-596(+) |
Amino Acid sequence : | |||
| TTLRERERERERERETFREPRAEFGTRVSAIGADRVGVRISPAIDHLDAMDSDPLNLGLAVIERLNKIQLDCGSKLAYLHITQPRYTAYGQTESGRHGTADEEAQMMRTWRRTYEGTFIS SGGFTRQLGIEAVAQGDADLVAYGRLFISNPDLVLRLKLNAPLTKYVRATFYTHDPVVGYTDYPFLKSDGEKPASRL* | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 22,254.780 | ||
| Theoretical pI: | 6.862 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 18910 | ||
| Instability index: | 30.606 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.547 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.198 | ||
| sheet | 0.274 | ||