| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339990.1 | 5prime_partial | 228 | 795-109(-) |
Amino Acid sequence : | |||
| DRWSMDEIDRLPDYMKIVLHFVMSAYEEYERDAKKNGKKFASPYFKETIQQLARGYNQELKWVMEKQMPPFKDYLKNSEITSSIYIMFASIIPGLKSFTQEAIDWIKNEPNFAVKAGLIG RYWDDIGSHKRESKGGEMLTVMDCYMKQYSVSIQETISEFAKAVEDSWKEVNEGWVYTISMPKEITVQFLNYSRMCDASYNRNNGDGYTDPSFAKSNITALFVDPIII* | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 26,580.975 | ||
| Theoretical pI: | 5.257 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 53860 53985 | ||
| Instability index: | 35.778 | ||
| aromaticity | 0.136 | ||
| GRAVY | -0.491 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.219 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339990.1 | 5prime_partial | 228 | 795-109(-) |
Amino Acid sequence : | |||
| DRWSMDEIDRLPDYMKIVLHFVMSAYEEYERDAKKNGKKFASPYFKETIQQLARGYNQELKWVMEKQMPPFKDYLKNSEITSSIYIMFASIIPGLKSFTQEAIDWIKNEPNFAVKAGLIG RYWDDIGSHKRESKGGEMLTVMDCYMKQYSVSIQETISEFAKAVEDSWKEVNEGWVYTISMPKEITVQFLNYSRMCDASYNRNNGDGYTDPSFAKSNITALFVDPIII* | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 26,580.975 | ||
| Theoretical pI: | 5.257 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 53860 53985 | ||
| Instability index: | 35.778 | ||
| aromaticity | 0.136 | ||
| GRAVY | -0.491 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.219 | ||
| sheet | 0.228 | ||