| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340005.1 | 5prime_partial | 209 | 676-47(-) |
Amino Acid sequence : | |||
| LPGARKEQLRRVISHPQALSQCEHTLTNMGLNVAREAVDDTAGAAEYIAANNLLDTAAIASSRAAELYGLQVLADGIQDDSSNVTRFVMLAREPIIPRTDRPFKTSIVFVHEKGTSVLFK VLSAFAFRNINLTKIESRPPRNRPIRVEDDVIGTAKHFEYMFYIDIEASMAEARAQNALAEVQEFTSFLRGLGSYPMDMTPWTPSFSQD* | |||
Physicochemical properties | |||
| Number of amino acids: | 209 | ||
| Molecular weight: | 23,249.104 | ||
| Theoretical pI: | 5.631 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 34.452 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.196 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.211 | ||
| sheet | 0.297 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340005.1 | 5prime_partial | 209 | 676-47(-) |
Amino Acid sequence : | |||
| LPGARKEQLRRVISHPQALSQCEHTLTNMGLNVAREAVDDTAGAAEYIAANNLLDTAAIASSRAAELYGLQVLADGIQDDSSNVTRFVMLAREPIIPRTDRPFKTSIVFVHEKGTSVLFK VLSAFAFRNINLTKIESRPPRNRPIRVEDDVIGTAKHFEYMFYIDIEASMAEARAQNALAEVQEFTSFLRGLGSYPMDMTPWTPSFSQD* | |||
Physicochemical properties | |||
| Number of amino acids: | 209 | ||
| Molecular weight: | 23,249.104 | ||
| Theoretical pI: | 5.631 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 34.452 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.196 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.211 | ||
| sheet | 0.297 | ||