| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340021.1 | 5prime_partial | 203 | 724-113(-) |
Amino Acid sequence : | |||
| DPNRDPDKVVDETCWSDLEFCKNTKNWYCYGKAVAEQAAWETAKELGVDLVVLNPVLVLGSLLQPTVNASVLHILKYLTGFAKTYANFIQAYVDVKDVALAHILLFENPAAFGRYFCAER VLHRGEVVEIFAKFFPEYPIPTKCSDEKNPRKKPYKFSNQKLKDLGLEFTPVRQSLYDTVKSFQEKGHFPIPTQNEDPVCIHP* | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 23,159.282 | ||
| Theoretical pI: | 6.242 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30285 | ||
| Instability index: | 23.427 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.276 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.197 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340021.1 | 5prime_partial | 203 | 724-113(-) |
Amino Acid sequence : | |||
| DPNRDPDKVVDETCWSDLEFCKNTKNWYCYGKAVAEQAAWETAKELGVDLVVLNPVLVLGSLLQPTVNASVLHILKYLTGFAKTYANFIQAYVDVKDVALAHILLFENPAAFGRYFCAER VLHRGEVVEIFAKFFPEYPIPTKCSDEKNPRKKPYKFSNQKLKDLGLEFTPVRQSLYDTVKSFQEKGHFPIPTQNEDPVCIHP* | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 23,159.282 | ||
| Theoretical pI: | 6.242 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30285 | ||
| Instability index: | 23.427 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.276 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.197 | ||
| sheet | 0.236 | ||