Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340056.1 | internal | 250 | 751-2(-) |
Amino Acid sequence : | |||
EWLSVLEKLHGKPVIPVGLMALERDGVEGGGNESWDKIRKWLENQEKGSVVYVALGREVTPSQDQLTELAHGLELSGVPFFWVLRKASGSGWVELPEGFEERVSGRGMVWRSWVPQVKIL SHDSGGGFLTHCGGSSIVEGLPFGRPLITLPFMGDQGLNSRVVVERQLGAEIARNELGGAYPRNSVADSVRQVMVEDGGKKLRENAQEISPVFGDVELQHRYVNDLVHFLENKKTISGRY YFNKVKKSFF | |||
Physicochemical properties | |||
Number of amino acids: | 250 | ||
Molecular weight: | 27,832.319 | ||
Theoretical pI: | 6.371 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 45950 45950 | ||
Instability index: | 38.994 | ||
aromaticity | 0.092 | ||
GRAVY | -0.306 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.280 | ||
sheet | 0.244 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340056.1 | internal | 250 | 751-2(-) |
Amino Acid sequence : | |||
EWLSVLEKLHGKPVIPVGLMALERDGVEGGGNESWDKIRKWLENQEKGSVVYVALGREVTPSQDQLTELAHGLELSGVPFFWVLRKASGSGWVELPEGFEERVSGRGMVWRSWVPQVKIL SHDSGGGFLTHCGGSSIVEGLPFGRPLITLPFMGDQGLNSRVVVERQLGAEIARNELGGAYPRNSVADSVRQVMVEDGGKKLRENAQEISPVFGDVELQHRYVNDLVHFLENKKTISGRY YFNKVKKSFF | |||
Physicochemical properties | |||
Number of amino acids: | 250 | ||
Molecular weight: | 27,832.319 | ||
Theoretical pI: | 6.371 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 45950 45950 | ||
Instability index: | 38.994 | ||
aromaticity | 0.092 | ||
GRAVY | -0.306 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.280 | ||
sheet | 0.244 |