| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340073.1 | 5prime_partial | 216 | 824-174(-) |
Amino Acid sequence : | |||
| GMTEISAIYELFNEPEEALKLLQKAMKLLEDKPGQHSTVAGIEARMGVMYYMVGRYEDSRGSFESAVAKLRASGERKSAFFGVVLNQMGLACVQLFKIDEAAELFEEAREILESECGPCH QDTLGVYSNLAATYDAMGRIEDAIEILEYVLKLREEKLGTANPDFDDEKKRLAELLKEAGRSRNKKAKSLENLIDLNSKRTKKEVSKKWSAFGFRS* | |||
Physicochemical properties | |||
| Number of amino acids: | 216 | ||
| Molecular weight: | 13,585.244 | ||
| Theoretical pI: | 10.103 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 46.764 | ||
| aromaticity | 0.157 | ||
| GRAVY | 0.116 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.322 | ||
| sheet | 0.215 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340073.1 | complete | 121 | 100-465(+) |
Amino Acid sequence : | |||
| MTIKHPTNKHHSPSSNLSHQILYATQLLNPNADHFFDTSFFVLFEFRSIRFSSDFAFLFLDLPASFNSSASLFFSSSKSGFAVPSFSSRSLRTYSRISIASSILPMASYVAARLLYTPRV S* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 13,585.244 | ||
| Theoretical pI: | 10.103 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 46.764 | ||
| aromaticity | 0.157 | ||
| GRAVY | 0.116 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.322 | ||
| sheet | 0.215 | ||