Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340073.1 | 5prime_partial | 216 | 824-174(-) |
Amino Acid sequence : | |||
GMTEISAIYELFNEPEEALKLLQKAMKLLEDKPGQHSTVAGIEARMGVMYYMVGRYEDSRGSFESAVAKLRASGERKSAFFGVVLNQMGLACVQLFKIDEAAELFEEAREILESECGPCH QDTLGVYSNLAATYDAMGRIEDAIEILEYVLKLREEKLGTANPDFDDEKKRLAELLKEAGRSRNKKAKSLENLIDLNSKRTKKEVSKKWSAFGFRS* | |||
Physicochemical properties | |||
Number of amino acids: | 216 | ||
Molecular weight: | 13,585.244 | ||
Theoretical pI: | 10.103 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
Instability index: | 46.764 | ||
aromaticity | 0.157 | ||
GRAVY | 0.116 | ||
Secondary Structure Fraction | |||
Helix | 0.347 | ||
turn | 0.322 | ||
sheet | 0.215 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340073.1 | complete | 121 | 100-465(+) |
Amino Acid sequence : | |||
MTIKHPTNKHHSPSSNLSHQILYATQLLNPNADHFFDTSFFVLFEFRSIRFSSDFAFLFLDLPASFNSSASLFFSSSKSGFAVPSFSSRSLRTYSRISIASSILPMASYVAARLLYTPRV S* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 13,585.244 | ||
Theoretical pI: | 10.103 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
Instability index: | 46.764 | ||
aromaticity | 0.157 | ||
GRAVY | 0.116 | ||
Secondary Structure Fraction | |||
Helix | 0.347 | ||
turn | 0.322 | ||
sheet | 0.215 |