| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340083.1 | 3prime_partial | 164 | 132-623(+) |
Amino Acid sequence : | |||
| MRTRRGLSYPKLANNFAENDSDRLLKRRKVDAAAVKEIDCREELKFSPDSDGNLAGRRDLFDALPDDLVVCVLCKLSSTARCPADFINALITCKRLNELGLSSTVLSKACREMVAVKATK WSESAHRFLKLCADAGNAKACYTLSMIRFYCLDKRGSGASLMAR | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 18,187.932 | ||
| Theoretical pI: | 9.229 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10470 | ||
| Instability index: | 39.826 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.216 | ||
Secondary Structure Fraction | |||
| Helix | 0.262 | ||
| turn | 0.195 | ||
| sheet | 0.317 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340083.1 | 3prime_partial | 164 | 132-623(+) |
Amino Acid sequence : | |||
| MRTRRGLSYPKLANNFAENDSDRLLKRRKVDAAAVKEIDCREELKFSPDSDGNLAGRRDLFDALPDDLVVCVLCKLSSTARCPADFINALITCKRLNELGLSSTVLSKACREMVAVKATK WSESAHRFLKLCADAGNAKACYTLSMIRFYCLDKRGSGASLMAR | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 18,187.932 | ||
| Theoretical pI: | 9.229 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10470 | ||
| Instability index: | 39.826 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.216 | ||
Secondary Structure Fraction | |||
| Helix | 0.262 | ||
| turn | 0.195 | ||
| sheet | 0.317 | ||