| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340132.1 | internal | 279 | 1-837(+) |
Amino Acid sequence : | |||
| IVDLVGFNDYQLQMQPFLIELVISYQIIHRLRDLFALYDRPQVEGSPFPSSILLGIDLLTVLTSKFRESYSIDWDSFPNDIAQENQLEEREHSTTTDLRCESSMDKRPSLQTGNIPTDLL NVPKDREDGYSNTREASSKIPISGNSHEIEHIASEVPVQEVMNELPRTLTEDKRQSFVAESSNNGACNVAELKNRNGSDPKQPAAFLLAVMSETGLVCLPSMLTAVLLQGNNRLSAEQSS YVLPSNFEEVATGVLKVLNNLAVIDISFIQKMLAQPDLK | |||
Physicochemical properties | |||
| Number of amino acids: | 279 | ||
| Molecular weight: | 31,126.775 | ||
| Theoretical pI: | 4.640 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 55.866 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.265 | ||
Secondary Structure Fraction | |||
| Helix | 0.312 | ||
| turn | 0.265 | ||
| sheet | 0.276 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340132.1 | internal | 279 | 1-837(+) |
Amino Acid sequence : | |||
| IVDLVGFNDYQLQMQPFLIELVISYQIIHRLRDLFALYDRPQVEGSPFPSSILLGIDLLTVLTSKFRESYSIDWDSFPNDIAQENQLEEREHSTTTDLRCESSMDKRPSLQTGNIPTDLL NVPKDREDGYSNTREASSKIPISGNSHEIEHIASEVPVQEVMNELPRTLTEDKRQSFVAESSNNGACNVAELKNRNGSDPKQPAAFLLAVMSETGLVCLPSMLTAVLLQGNNRLSAEQSS YVLPSNFEEVATGVLKVLNNLAVIDISFIQKMLAQPDLK | |||
Physicochemical properties | |||
| Number of amino acids: | 279 | ||
| Molecular weight: | 31,126.775 | ||
| Theoretical pI: | 4.640 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 55.866 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.265 | ||
Secondary Structure Fraction | |||
| Helix | 0.312 | ||
| turn | 0.265 | ||
| sheet | 0.276 | ||