Acc_NO	ORF type	length	start-end position (strand +/-)
>DY340136.1	5prime_partial	252	804-46(-)
Amino Acid sequence :
KRVRPILCITACELVGGEESTAMPAACAVEMIQTMSLMHDDLPFMDNDDLRRGKPTNHKVFGENAAVLAGDAMLSFAFEHVAAATRGVAPERVVRAVRELANLIGSEGLSGGQVVDVSSE GMAAVGLDHLELIHRLKTAALVQASVVLGAVVGGASEEEIEKLRRFASCIGLLFQVVDDILDVTKSSAELGKTAGKDLAADKATYPKLIGLEKSRELADKLNREAKEQLLHFDPHRAAPL IALADYIAYRDY*
Physicochemical properties
Number of amino acids:		252
Molecular weight:		16,254.345
Theoretical pI:		11.436
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5625
Instability index:		68.995
aromaticity		0.019
GRAVY		-1.193
Secondary Structure Fraction
Helix		0.106
turn		0.400
sheet		0.169

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY340136.1	5prime_partial	226	1-681(+)
Amino Acid sequence :
DIMKLIYLLRPLKYRSIISVSNIIRESNQGGSPVRIKVKQLFLCLPIQFVGQFSGFLQPNQLWIRGFIRRQILSGRLPQFRRRFRHIQNVIHHLKQQPYTARKSPQFLNFLLARSSHNRP QNHRRLHQRRRLQAVDQLQVIESHSRHPLRTDVHHLTPRQPLRPDQIRQLPHRPHHSLRRHAPRRGGHVFERERQHGVAGQHRRVLAEHLVVGGLPAAEVVVVHEG*
Physicochemical properties
Number of amino acids:		226
Molecular weight:		16,254.345
Theoretical pI:		11.436
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5625
Instability index:		68.995
aromaticity		0.019
GRAVY		-1.193
Secondary Structure Fraction
Helix		0.106
turn		0.400
sheet		0.169

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY340136.1	5prime_partial	160	805-323(-)
Amino Acid sequence :
QESAADPLHHGLRAGWRRGIHGHAGGLRRRDDPDHVPDARRPTLHGQRRPPPREAHQPQGVRRERGGAGRRRHAVVRVRTRGRRDEGRGAGESGEGGAGAGEFDRVGGAVGGSGGGRQFG GDGGCGTRSPGVDPPPEDGGAGAGVGGSGGGCGRSERGGN*
Physicochemical properties
Number of amino acids:		160
Molecular weight:		16,254.345
Theoretical pI:		11.436
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5625
Instability index:		68.995
aromaticity		0.019
GRAVY		-1.193
Secondary Structure Fraction
Helix		0.106
turn		0.400
sheet		0.169

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY340136.1	5prime_partial	252	804-46(-)
Amino Acid sequence :
KRVRPILCITACELVGGEESTAMPAACAVEMIQTMSLMHDDLPFMDNDDLRRGKPTNHKVFGENAAVLAGDAMLSFAFEHVAAATRGVAPERVVRAVRELANLIGSEGLSGGQVVDVSSE GMAAVGLDHLELIHRLKTAALVQASVVLGAVVGGASEEEIEKLRRFASCIGLLFQVVDDILDVTKSSAELGKTAGKDLAADKATYPKLIGLEKSRELADKLNREAKEQLLHFDPHRAAPL IALADYIAYRDY*
Physicochemical properties
Number of amino acids:		252
Molecular weight:		16,254.345
Theoretical pI:		11.436
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5625
Instability index:		68.995
aromaticity		0.019
GRAVY		-1.193
Secondary Structure Fraction
Helix		0.106
turn		0.400
sheet		0.169

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY340136.1	5prime_partial	226	1-681(+)
Amino Acid sequence :
DIMKLIYLLRPLKYRSIISVSNIIRESNQGGSPVRIKVKQLFLCLPIQFVGQFSGFLQPNQLWIRGFIRRQILSGRLPQFRRRFRHIQNVIHHLKQQPYTARKSPQFLNFLLARSSHNRP QNHRRLHQRRRLQAVDQLQVIESHSRHPLRTDVHHLTPRQPLRPDQIRQLPHRPHHSLRRHAPRRGGHVFERERQHGVAGQHRRVLAEHLVVGGLPAAEVVVVHEG*
Physicochemical properties
Number of amino acids:		226
Molecular weight:		16,254.345
Theoretical pI:		11.436
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5625
Instability index:		68.995
aromaticity		0.019
GRAVY		-1.193
Secondary Structure Fraction
Helix		0.106
turn		0.400
sheet		0.169

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY340136.1	5prime_partial	160	805-323(-)
Amino Acid sequence :
QESAADPLHHGLRAGWRRGIHGHAGGLRRRDDPDHVPDARRPTLHGQRRPPPREAHQPQGVRRERGGAGRRRHAVVRVRTRGRRDEGRGAGESGEGGAGAGEFDRVGGAVGGSGGGRQFG GDGGCGTRSPGVDPPPEDGGAGAGVGGSGGGCGRSERGGN*
Physicochemical properties
Number of amino acids:		160
Molecular weight:		16,254.345
Theoretical pI:		11.436
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5625
Instability index:		68.995
aromaticity		0.019
GRAVY		-1.193
Secondary Structure Fraction
Helix		0.106
turn		0.400
sheet		0.169