| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340141.1 | 5prime_partial | 251 | 791-36(-) |
Amino Acid sequence : | |||
| TEAVVIKHSFEFEPEWLSVLEKLHGKPVIPVGLMALERDGVEGGGNESWDKIRKWLENQEKGSVVYVALGSEVTPSQDQLTELAHGLELSGVPFFWVLRKASGSGWVELPEGFEERVSGR GMVWRSWVPQVKILSHDSVGGFLTHCGWSSIVEGLTFGRPLITLPFMVDQGLNSRVVVERQLGAEIARNELDGAYTRNSVADSVRQVMVEDGGKKLRENAQEISAVFGDVELQHRYVNEL VHFLENYKTIS* | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 28,014.395 | ||
| Theoretical pI: | 5.172 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 49960 49960 | ||
| Instability index: | 33.899 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.195 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.251 | ||
| sheet | 0.267 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340141.1 | 5prime_partial | 251 | 791-36(-) |
Amino Acid sequence : | |||
| TEAVVIKHSFEFEPEWLSVLEKLHGKPVIPVGLMALERDGVEGGGNESWDKIRKWLENQEKGSVVYVALGSEVTPSQDQLTELAHGLELSGVPFFWVLRKASGSGWVELPEGFEERVSGR GMVWRSWVPQVKILSHDSVGGFLTHCGWSSIVEGLTFGRPLITLPFMVDQGLNSRVVVERQLGAEIARNELDGAYTRNSVADSVRQVMVEDGGKKLRENAQEISAVFGDVELQHRYVNEL VHFLENYKTIS* | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 28,014.395 | ||
| Theoretical pI: | 5.172 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 49960 49960 | ||
| Instability index: | 33.899 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.195 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.251 | ||
| sheet | 0.267 | ||