| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340156.1 | internal | 151 | 1-453(+) |
Amino Acid sequence : | |||
| ARGLASNSARGLYGCRHSLPDGLMRATDVLIAGKVGVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGFQVLTLEDVLSEADIFVTTTGNKDIIMVDHMKKMNNNAIVCNIG HFHNEIDMLGLDTYPGVKRITIKPHTDRWVF | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 16,210.782 | ||
| Theoretical pI: | 5.530 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 33.575 | ||
| aromaticity | 0.033 | ||
| GRAVY | -0.240 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.258 | ||
| sheet | 0.199 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340156.1 | internal | 151 | 453-1(-) |
Amino Acid sequence : | |||
| EHPSVSMWLDGDPLHTGVGVKTQHVDLVVEVANVADNGIVVHLLHVVDHNDVLVAGGGDKDVGLRKNILQGQDLEAFHEGLESADWIDLGDDHTSTGLFQGRGTTLPNITITTHNSHLSG NQYISSPHKSIRQRVAASVQASCRIRSEASC | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 16,210.782 | ||
| Theoretical pI: | 5.530 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 33.575 | ||
| aromaticity | 0.033 | ||
| GRAVY | -0.240 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.258 | ||
| sheet | 0.199 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340156.1 | internal | 151 | 1-453(+) |
Amino Acid sequence : | |||
| ARGLASNSARGLYGCRHSLPDGLMRATDVLIAGKVGVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQALMEGFQVLTLEDVLSEADIFVTTTGNKDIIMVDHMKKMNNNAIVCNIG HFHNEIDMLGLDTYPGVKRITIKPHTDRWVF | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 16,210.782 | ||
| Theoretical pI: | 5.530 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 33.575 | ||
| aromaticity | 0.033 | ||
| GRAVY | -0.240 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.258 | ||
| sheet | 0.199 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340156.1 | internal | 151 | 453-1(-) |
Amino Acid sequence : | |||
| EHPSVSMWLDGDPLHTGVGVKTQHVDLVVEVANVADNGIVVHLLHVVDHNDVLVAGGGDKDVGLRKNILQGQDLEAFHEGLESADWIDLGDDHTSTGLFQGRGTTLPNITITTHNSHLSG NQYISSPHKSIRQRVAASVQASCRIRSEASC | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 16,210.782 | ||
| Theoretical pI: | 5.530 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 33.575 | ||
| aromaticity | 0.033 | ||
| GRAVY | -0.240 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.258 | ||
| sheet | 0.199 | ||