| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340171.1 | 5prime_partial | 252 | 789-31(-) |
Amino Acid sequence : | |||
| YSDIQRAGHVIAGTEAVVIKHSFEFEPEWLSVLEKLHGKPVIPVGLMALERDGVEGGGNESWDKIRKWLENQEKGSVVYVALGSEVTPSQDQLTELAHGLELSGVPFFWVLRKASGSGWV ELPEGFEERVSGRGMVWRSWVPQVKILSHDSVGGFLTHCGWSSIVEGLTFGRPLITLPFMVDQGLNSRVVVERQLGAEIARNELDGEYTRNSVADSVRQVMVEDGGKKLRENAQEISAVF GDVELQHRYVTV* | |||
Physicochemical properties | |||
| Number of amino acids: | 252 | ||
| Molecular weight: | 27,952.286 | ||
| Theoretical pI: | 5.165 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 49960 49960 | ||
| Instability index: | 33.579 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.186 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.250 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340171.1 | 5prime_partial | 252 | 789-31(-) |
Amino Acid sequence : | |||
| YSDIQRAGHVIAGTEAVVIKHSFEFEPEWLSVLEKLHGKPVIPVGLMALERDGVEGGGNESWDKIRKWLENQEKGSVVYVALGSEVTPSQDQLTELAHGLELSGVPFFWVLRKASGSGWV ELPEGFEERVSGRGMVWRSWVPQVKILSHDSVGGFLTHCGWSSIVEGLTFGRPLITLPFMVDQGLNSRVVVERQLGAEIARNELDGEYTRNSVADSVRQVMVEDGGKKLRENAQEISAVF GDVELQHRYVTV* | |||
Physicochemical properties | |||
| Number of amino acids: | 252 | ||
| Molecular weight: | 27,952.286 | ||
| Theoretical pI: | 5.165 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 49960 49960 | ||
| Instability index: | 33.579 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.186 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.250 | ||
| sheet | 0.258 | ||