Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340194.1 | complete | 237 | 49-762(+) |
Amino Acid sequence : | |||
MVTGASSGLGHEFCLDLAQANCKIVAAARRVDRLNSLCDHINIMDVPTSDANSGPTRAIPVVLDVRSDGPTIEACMERAWNAFGHIDVLINNAGVRGGKTLALEFPEDEFNNVHNTNYKG AWLVSKYIGARMRDRGRGGSIINISSVSGLNRTQSHGSIAYGPSKAALDSMTKIMAVELGRYNIRVNSIVPGILKSEITENLFKKSWAKKCSRENTSPHNNRNNKSSNNNSHSLFNS* | |||
Physicochemical properties | |||
Number of amino acids: | 237 | ||
Molecular weight: | 25,769.801 | ||
Theoretical pI: | 9.298 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
Instability index: | 41.224 | ||
aromaticity | 0.055 | ||
GRAVY | -0.369 | ||
Secondary Structure Fraction | |||
Helix | 0.257 | ||
turn | 0.325 | ||
sheet | 0.219 |