| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340194.1 | complete | 237 | 49-762(+) |
Amino Acid sequence : | |||
| MVTGASSGLGHEFCLDLAQANCKIVAAARRVDRLNSLCDHINIMDVPTSDANSGPTRAIPVVLDVRSDGPTIEACMERAWNAFGHIDVLINNAGVRGGKTLALEFPEDEFNNVHNTNYKG AWLVSKYIGARMRDRGRGGSIINISSVSGLNRTQSHGSIAYGPSKAALDSMTKIMAVELGRYNIRVNSIVPGILKSEITENLFKKSWAKKCSRENTSPHNNRNNKSSNNNSHSLFNS* | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 25,769.801 | ||
| Theoretical pI: | 9.298 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
| Instability index: | 41.224 | ||
| aromaticity | 0.055 | ||
| GRAVY | -0.369 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.325 | ||
| sheet | 0.219 | ||