Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340195.1 | 5prime_partial | 214 | 676-32(-) |
Amino Acid sequence : | |||
LAQANCKIVAAARRVDRLNSLCDHINIMDVPTSDANSGPTRAIPVVLDVRSDGPTIEACMERAWNAFGHIDVLINNAGVRGGKTLALEFPEDEFNNVHNTNYKGAWLVSKYIGARMRDRG RGGSIINISSVSGLNRTQSHGSIAYGPSKAALDSMTKIMAVELGRYNIRVNSIVPGILKSEITENLFKKSWAKKCSRENTSPQNNRNNKSSNNN* | |||
Physicochemical properties | |||
Number of amino acids: | 214 | ||
Molecular weight: | 23,382.196 | ||
Theoretical pI: | 9.621 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
Instability index: | 43.764 | ||
aromaticity | 0.051 | ||
GRAVY | -0.432 | ||
Secondary Structure Fraction | |||
Helix | 0.257 | ||
turn | 0.318 | ||
sheet | 0.215 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340195.1 | 5prime_partial | 214 | 676-32(-) |
Amino Acid sequence : | |||
LAQANCKIVAAARRVDRLNSLCDHINIMDVPTSDANSGPTRAIPVVLDVRSDGPTIEACMERAWNAFGHIDVLINNAGVRGGKTLALEFPEDEFNNVHNTNYKGAWLVSKYIGARMRDRG RGGSIINISSVSGLNRTQSHGSIAYGPSKAALDSMTKIMAVELGRYNIRVNSIVPGILKSEITENLFKKSWAKKCSRENTSPQNNRNNKSSNNN* | |||
Physicochemical properties | |||
Number of amino acids: | 214 | ||
Molecular weight: | 23,382.196 | ||
Theoretical pI: | 9.621 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
Instability index: | 43.764 | ||
aromaticity | 0.051 | ||
GRAVY | -0.432 | ||
Secondary Structure Fraction | |||
Helix | 0.257 | ||
turn | 0.318 | ||
sheet | 0.215 |