| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340197.1 | internal | 245 | 3-737(+) |
Amino Acid sequence : | |||
| TRHRLQSNVLGVEYHFEHEIEESLKYIRDNYMQHNSKDNDLCKVALRFRLLRQQGYNVPCDVFKNFINDQGNFAESIKDDVESLLHFYEAAHLGVHGEEILDKAIEFCSCHLQSSLHQMS NVSLSKRVEKALRMPIRWSVPRLEAREFISMYEEDESHNEILLNFAKLDFNMVQKMHQRELSDATRWWKRFDVANTMPYARDRIVEIFFWMVGVYSEPRYATARRIITKAIGTVSIIDDT YEYAT | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 29,050.621 | ||
| Theoretical pI: | 6.001 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38390 38640 | ||
| Instability index: | 61.653 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.482 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.171 | ||
| sheet | 0.265 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340197.1 | internal | 245 | 3-737(+) |
Amino Acid sequence : | |||
| TRHRLQSNVLGVEYHFEHEIEESLKYIRDNYMQHNSKDNDLCKVALRFRLLRQQGYNVPCDVFKNFINDQGNFAESIKDDVESLLHFYEAAHLGVHGEEILDKAIEFCSCHLQSSLHQMS NVSLSKRVEKALRMPIRWSVPRLEAREFISMYEEDESHNEILLNFAKLDFNMVQKMHQRELSDATRWWKRFDVANTMPYARDRIVEIFFWMVGVYSEPRYATARRIITKAIGTVSIIDDT YEYAT | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 29,050.621 | ||
| Theoretical pI: | 6.001 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38390 38640 | ||
| Instability index: | 61.653 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.482 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.171 | ||
| sheet | 0.265 | ||