| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340203.1 | 5prime_partial | 134 | 581-177(-) |
Amino Acid sequence : | |||
| TRASYTVDYRAPVGNKTVEFSPAEVARVFKYLYQSSANPIFENMTWRQCGEAFAGDIVRYFKELQPDAQSWLVKSNPVLAGNAPWVALDVTDGLDIRHLNPEEKKVIARAKNPLLRSMQL KGRESLSAEALLES* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 11,692.500 | ||
| Theoretical pI: | 9.557 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 34.464 | ||
| aromaticity | 0.119 | ||
| GRAVY | 0.353 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.275 | ||
| sheet | 0.284 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340203.1 | complete | 109 | 229-558(+) |
Amino Acid sequence : | |||
| MDLNRGFLALAITFFSSGFKCLISRPSVTSKATHGAFPAKTGLDLTNQLCASGWSSLKYLTMSPAKASPHCLHVIFSKIGFAELWYKYLNTLATSAGLNSTVLFPTGAL* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 11,692.500 | ||
| Theoretical pI: | 9.557 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 34.464 | ||
| aromaticity | 0.119 | ||
| GRAVY | 0.353 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.275 | ||
| sheet | 0.284 | ||