Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340203.1 | 5prime_partial | 134 | 581-177(-) |
Amino Acid sequence : | |||
TRASYTVDYRAPVGNKTVEFSPAEVARVFKYLYQSSANPIFENMTWRQCGEAFAGDIVRYFKELQPDAQSWLVKSNPVLAGNAPWVALDVTDGLDIRHLNPEEKKVIARAKNPLLRSMQL KGRESLSAEALLES* | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 11,692.500 | ||
Theoretical pI: | 9.557 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 34.464 | ||
aromaticity | 0.119 | ||
GRAVY | 0.353 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.275 | ||
sheet | 0.284 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340203.1 | complete | 109 | 229-558(+) |
Amino Acid sequence : | |||
MDLNRGFLALAITFFSSGFKCLISRPSVTSKATHGAFPAKTGLDLTNQLCASGWSSLKYLTMSPAKASPHCLHVIFSKIGFAELWYKYLNTLATSAGLNSTVLFPTGAL* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 11,692.500 | ||
Theoretical pI: | 9.557 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 34.464 | ||
aromaticity | 0.119 | ||
GRAVY | 0.353 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.275 | ||
sheet | 0.284 |