Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340205.1 | internal | 224 | 3-674(+) |
Amino Acid sequence : | |||
TRYPLMARGNASVPAMEMTKWFDTNYHFIVPELGPDVKFSYSSHKAVHEYKEAKALGVDTVPVLVGPVTYLLLSKPAKGVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLV LDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTTLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLFAGVVDGRNIWANDLAASITALHALEG | |||
Physicochemical properties | |||
Number of amino acids: | 224 | ||
Molecular weight: | 24,381.710 | ||
Theoretical pI: | 5.228 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34380 | ||
Instability index: | 24.812 | ||
aromaticity | 0.112 | ||
GRAVY | 0.147 | ||
Secondary Structure Fraction | |||
Helix | 0.362 | ||
turn | 0.219 | ||
sheet | 0.308 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340205.1 | internal | 224 | 3-674(+) |
Amino Acid sequence : | |||
TRYPLMARGNASVPAMEMTKWFDTNYHFIVPELGPDVKFSYSSHKAVHEYKEAKALGVDTVPVLVGPVTYLLLSKPAKGVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLV LDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTTLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLFAGVVDGRNIWANDLAASITALHALEG | |||
Physicochemical properties | |||
Number of amino acids: | 224 | ||
Molecular weight: | 24,381.710 | ||
Theoretical pI: | 5.228 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34380 | ||
Instability index: | 24.812 | ||
aromaticity | 0.112 | ||
GRAVY | 0.147 | ||
Secondary Structure Fraction | |||
Helix | 0.362 | ||
turn | 0.219 | ||
sheet | 0.308 |