| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340210.1 | 5prime_partial | 162 | 2-490(+) |
Amino Acid sequence : | |||
| HTLRALSCTSNAMSKRRTREPKEENVTLGPATRDGELVFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMKVKADRDESSPYAAMLAAQDVSQRCKELGINALHIKLRATGGNKTKTPG PGAQSALRALARSGMKIGRIEDVTPIPTDSTRRKGGRRGRRL* | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 17,598.952 | ||
| Theoretical pI: | 10.693 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 59.862 | ||
| aromaticity | 0.031 | ||
| GRAVY | -0.554 | ||
Secondary Structure Fraction | |||
| Helix | 0.204 | ||
| turn | 0.241 | ||
| sheet | 0.253 | ||