Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340214.1 | 5prime_partial | 143 | 3-434(+) |
Amino Acid sequence : | |||
ILLESYLHPYGTNKQSHNKHKRNLLTSLSSSHYKSMPEKFVQRNMQSLIPVFRGVIFRSNNQTAPLSGTAIDGLHNVNELLLILQGPVDLVVVSSTKIDHNVFVSEEEHARRGVVQLIHR VEIRHFRDIHQVYDSKVLYCFSD* | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 14,643.120 | ||
Theoretical pI: | 10.116 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
Instability index: | 58.614 | ||
aromaticity | 0.093 | ||
GRAVY | -0.174 | ||
Secondary Structure Fraction | |||
Helix | 0.287 | ||
turn | 0.256 | ||
sheet | 0.209 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340214.1 | complete | 142 | 572-144(-) |
Amino Acid sequence : | |||
MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLASVAETIKNFAVIYLVDITEVPDFNTMYELYDPSTCMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVY RGARKGRGLVIAPKDYSTKYRY* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 14,643.120 | ||
Theoretical pI: | 10.116 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
Instability index: | 58.614 | ||
aromaticity | 0.093 | ||
GRAVY | -0.174 | ||
Secondary Structure Fraction | |||
Helix | 0.287 | ||
turn | 0.256 | ||
sheet | 0.209 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340214.1 | complete | 129 | 229-618(+) |
Amino Acid sequence : | |||
MSMNSCLSFKAQLILLLFPVPRSIIMCLFLKKNMHVEGSYSSYIVLKSGTSVISTRYMTAKFFIVSATEASTSSICMQVSSQSWPKRMITRRSSSARIAWSTAHPEWRCGSKYDIVSQGK KEKKKKKEQ* | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 14,643.120 | ||
Theoretical pI: | 10.116 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
Instability index: | 58.614 | ||
aromaticity | 0.093 | ||
GRAVY | -0.174 | ||
Secondary Structure Fraction | |||
Helix | 0.287 | ||
turn | 0.256 | ||
sheet | 0.209 |