Acc_NO	ORF type	length	start-end position (strand +/-)
>DY340232.1	5prime_partial	136	671-261(-)
Amino Acid sequence :
SFRITSVGVQDTTQIHTHMWYSNFNDIIHSIINMDADVITIENSRSDEKLLLVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLETNILWVNPDCGLKTRKYAEVKPALEN MVSAAKLLRTQLASAK*
Physicochemical properties
Number of amino acids:		136
Molecular weight:		12,261.192
Theoretical pI:		9.689
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		27960 27960
Instability index:		51.936
aromaticity		0.140
GRAVY		0.144
Secondary Structure Fraction
Helix		0.327
turn		0.290
sheet		0.271

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY340232.1	complete	107	310-633(+)
Amino Acid sequence :
MFSRAGFTSAYFRVLRPQSGFTHKMLVSRTASILLMRSAISSVDGILGEWMSYTPGPIPAPYFTPSRNTNSSFSSEREFSIVITSASMLMMEWMMSLKLEYHMWVWI*
Physicochemical properties
Number of amino acids:		107
Molecular weight:		12,261.192
Theoretical pI:		9.689
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		27960 27960
Instability index:		51.936
aromaticity		0.140
GRAVY		0.144
Secondary Structure Fraction
Helix		0.327
turn		0.290
sheet		0.271