| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340259.1 | internal | 272 | 3-818(+) |
Amino Acid sequence : | |||
| SQTQSFLGLELMDALSIVDESLRNVRPPITSYAPSIWSHTFSKSSFKDQEHVQNKYEEAIEELKIQVRGKLMAAATPLKQMIFIDTLERLGLAYHFETEIEHKLQKIYNDDVCGDDCDLF TTTLRFRLLRQHRHRVSCDVFDKFVYEEGKFKGDAEGLLSLYEATHVRFHNEKILKEAEKFARHELNCMESKLQSPLKDKVKRALERPLHREVPIIYARLFISIYEKDDSRDEHLLKLAK FNFNFLQNLYRKELFDLTKWWKEFDXQTKLPY | |||
Physicochemical properties | |||
| Number of amino acids: | 272 | ||
| Molecular weight: | 14,752.180 | ||
| Theoretical pI: | 8.784 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24785 | ||
| Instability index: | 52.671 | ||
| aromaticity | 0.174 | ||
| GRAVY | 0.107 | ||
Secondary Structure Fraction | |||
| Helix | 0.430 | ||
| turn | 0.140 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340259.1 | complete | 121 | 398-33(-) |
Amino Acid sequence : | |||
| MLSEQTKSKCCREQITIVSTNVIVVYFLEFVFDLRLEMVGQSQSLERVNEYHLFERRCCSHQLASYLYLQFFDCFFILVLYMLLVLKRRFRESMRPYAWGITCYRWPYIPQTFIYNAKSI H* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 14,752.180 | ||
| Theoretical pI: | 8.784 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24785 | ||
| Instability index: | 52.671 | ||
| aromaticity | 0.174 | ||
| GRAVY | 0.107 | ||
Secondary Structure Fraction | |||
| Helix | 0.430 | ||
| turn | 0.140 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340259.1 | internal | 272 | 3-818(+) |
Amino Acid sequence : | |||
| SQTQSFLGLELMDALSIVDESLRNVRPPITSYAPSIWSHTFSKSSFKDQEHVQNKYEEAIEELKIQVRGKLMAAATPLKQMIFIDTLERLGLAYHFETEIEHKLQKIYNDDVCGDDCDLF TTTLRFRLLRQHRHRVSCDVFDKFVYEEGKFKGDAEGLLSLYEATHVRFHNEKILKEAEKFARHELNCMESKLQSPLKDKVKRALERPLHREVPIIYARLFISIYEKDDSRDEHLLKLAK FNFNFLQNLYRKELFDLTKWWKEFDXQTKLPY | |||
Physicochemical properties | |||
| Number of amino acids: | 272 | ||
| Molecular weight: | 14,752.180 | ||
| Theoretical pI: | 8.784 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24785 | ||
| Instability index: | 52.671 | ||
| aromaticity | 0.174 | ||
| GRAVY | 0.107 | ||
Secondary Structure Fraction | |||
| Helix | 0.430 | ||
| turn | 0.140 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340259.1 | complete | 121 | 398-33(-) |
Amino Acid sequence : | |||
| MLSEQTKSKCCREQITIVSTNVIVVYFLEFVFDLRLEMVGQSQSLERVNEYHLFERRCCSHQLASYLYLQFFDCFFILVLYMLLVLKRRFRESMRPYAWGITCYRWPYIPQTFIYNAKSI H* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 14,752.180 | ||
| Theoretical pI: | 8.784 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24785 | ||
| Instability index: | 52.671 | ||
| aromaticity | 0.174 | ||
| GRAVY | 0.107 | ||
Secondary Structure Fraction | |||
| Helix | 0.430 | ||
| turn | 0.140 | ||
| sheet | 0.240 | ||