Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340262.1 | internal | 259 | 1-777(+) |
Amino Acid sequence : | |||
ARTLTQSFLGLELMDALSIVDESLRNVRPPITSYAPSIWSHTFSKSSFKDQEHVQNKYEEAIEELKIQVRGKLMAAATPLKQMIFIDTLERLGLAYHFETEIEHKLQKIYNDDVCGDDCD LFTTTLRFRLLRQHRHRVSCDVFDKFVYEEGKFKGDAEGLLSLYEATHVRFHNEKILKEAEKFARHELNCMESKLQSPLKDKVKRALERPLHREVPIIYARLFISIYEKDDSRDEHLLKL AKFNFNFLQNLYRKELFDL | |||
Physicochemical properties | |||
Number of amino acids: | 259 | ||
Molecular weight: | 14,752.180 | ||
Theoretical pI: | 8.784 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24785 | ||
Instability index: | 52.671 | ||
aromaticity | 0.174 | ||
GRAVY | 0.107 | ||
Secondary Structure Fraction | |||
Helix | 0.430 | ||
turn | 0.140 | ||
sheet | 0.240 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340262.1 | complete | 121 | 402-37(-) |
Amino Acid sequence : | |||
MLSEQTKSKCCREQITIVSTNVIVVYFLEFVFDLRLEMVGQSQSLERVNEYHLFERRCCSHQLASYLYLQFFDCFFILVLYMLLVLKRRFRESMRPYAWGITCYRWPYIPQTFIYNAKSI H* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 14,752.180 | ||
Theoretical pI: | 8.784 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24785 | ||
Instability index: | 52.671 | ||
aromaticity | 0.174 | ||
GRAVY | 0.107 | ||
Secondary Structure Fraction | |||
Helix | 0.430 | ||
turn | 0.140 | ||
sheet | 0.240 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340262.1 | internal | 259 | 1-777(+) |
Amino Acid sequence : | |||
ARTLTQSFLGLELMDALSIVDESLRNVRPPITSYAPSIWSHTFSKSSFKDQEHVQNKYEEAIEELKIQVRGKLMAAATPLKQMIFIDTLERLGLAYHFETEIEHKLQKIYNDDVCGDDCD LFTTTLRFRLLRQHRHRVSCDVFDKFVYEEGKFKGDAEGLLSLYEATHVRFHNEKILKEAEKFARHELNCMESKLQSPLKDKVKRALERPLHREVPIIYARLFISIYEKDDSRDEHLLKL AKFNFNFLQNLYRKELFDL | |||
Physicochemical properties | |||
Number of amino acids: | 259 | ||
Molecular weight: | 14,752.180 | ||
Theoretical pI: | 8.784 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24785 | ||
Instability index: | 52.671 | ||
aromaticity | 0.174 | ||
GRAVY | 0.107 | ||
Secondary Structure Fraction | |||
Helix | 0.430 | ||
turn | 0.140 | ||
sheet | 0.240 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340262.1 | complete | 121 | 402-37(-) |
Amino Acid sequence : | |||
MLSEQTKSKCCREQITIVSTNVIVVYFLEFVFDLRLEMVGQSQSLERVNEYHLFERRCCSHQLASYLYLQFFDCFFILVLYMLLVLKRRFRESMRPYAWGITCYRWPYIPQTFIYNAKSI H* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 14,752.180 | ||
Theoretical pI: | 8.784 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24785 | ||
Instability index: | 52.671 | ||
aromaticity | 0.174 | ||
GRAVY | 0.107 | ||
Secondary Structure Fraction | |||
Helix | 0.430 | ||
turn | 0.140 | ||
sheet | 0.240 |