| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340284.1 | internal | 171 | 2-514(+) |
Amino Acid sequence : | |||
| KTPLSRRPTSPPDTPEDEYYASQGVRNSKSYFETPHGRLFTQSFLPLDPTQPVKASVFMTHGYGSDTGWMFQKFCINFASWGYAVFAADMLGHGRSDGIRGYIGDMNKVAAASLSFFRSV RVSEEYKDLPAFLMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEP | |||
Physicochemical properties | |||
| Number of amino acids: | 171 | ||
| Molecular weight: | 18,665.666 | ||
| Theoretical pI: | 6.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 76.258 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.551 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.234 | ||
| sheet | 0.316 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340284.1 | internal | 171 | 514-2(-) |
Amino Acid sequence : | |||
| GLGKDEERRREDEAGPQTLLRRLEIHEHRQQTAHRLPHEKRRQILVLLANPNAPEEGQRRRRHLIHIADVAADPVGAAVPQHIGGEHRVAPAGEVDAEFLEHPAGIRPVPVGHEDGGLHG LGRVEGEEGLGEEPPVWGFEVGFGIADALGGVVFVLRRVRGRSWAAAEGGF | |||
Physicochemical properties | |||
| Number of amino acids: | 171 | ||
| Molecular weight: | 18,665.666 | ||
| Theoretical pI: | 6.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 76.258 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.551 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.234 | ||
| sheet | 0.316 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340284.1 | internal | 171 | 2-514(+) |
Amino Acid sequence : | |||
| KTPLSRRPTSPPDTPEDEYYASQGVRNSKSYFETPHGRLFTQSFLPLDPTQPVKASVFMTHGYGSDTGWMFQKFCINFASWGYAVFAADMLGHGRSDGIRGYIGDMNKVAAASLSFFRSV RVSEEYKDLPAFLMGESMGGLLTMLMYFQSAEEGLWTGLIFSAPLFVFPEP | |||
Physicochemical properties | |||
| Number of amino acids: | 171 | ||
| Molecular weight: | 18,665.666 | ||
| Theoretical pI: | 6.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 76.258 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.551 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.234 | ||
| sheet | 0.316 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340284.1 | internal | 171 | 514-2(-) |
Amino Acid sequence : | |||
| GLGKDEERRREDEAGPQTLLRRLEIHEHRQQTAHRLPHEKRRQILVLLANPNAPEEGQRRRRHLIHIADVAADPVGAAVPQHIGGEHRVAPAGEVDAEFLEHPAGIRPVPVGHEDGGLHG LGRVEGEEGLGEEPPVWGFEVGFGIADALGGVVFVLRRVRGRSWAAAEGGF | |||
Physicochemical properties | |||
| Number of amino acids: | 171 | ||
| Molecular weight: | 18,665.666 | ||
| Theoretical pI: | 6.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 76.258 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.551 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.234 | ||
| sheet | 0.316 | ||