Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340298.1 | internal | 247 | 1-741(+) |
Amino Acid sequence : | |||
THRERERERETFVSILRDVRPPVTSYAPNIWADTFSNISLDEEVQKKYAETIEALKQVVRGMLMAAATPIKQMIFIDTLERLGLAYHFETEIEHKLQKIYDDNVCGDDCDLFTTALRFRL LRQHRHHVSCDVFDKFLYEEGKFKGDAEGLLSLYEASHVRFHNEKILEEAERFTRQELSCMESKLQSPLKDKVKRALVRPLHREVPILYARHFISIYEKDESMDEHLLKLAKFNFNFLQN LYKKELY | |||
Physicochemical properties | |||
Number of amino acids: | 247 | ||
Molecular weight: | 29,346.266 | ||
Theoretical pI: | 6.269 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20400 20650 | ||
Instability index: | 49.648 | ||
aromaticity | 0.105 | ||
GRAVY | -0.515 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.130 | ||
sheet | 0.308 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340298.1 | internal | 247 | 1-741(+) |
Amino Acid sequence : | |||
THRERERERETFVSILRDVRPPVTSYAPNIWADTFSNISLDEEVQKKYAETIEALKQVVRGMLMAAATPIKQMIFIDTLERLGLAYHFETEIEHKLQKIYDDNVCGDDCDLFTTALRFRL LRQHRHHVSCDVFDKFLYEEGKFKGDAEGLLSLYEASHVRFHNEKILEEAERFTRQELSCMESKLQSPLKDKVKRALVRPLHREVPILYARHFISIYEKDESMDEHLLKLAKFNFNFLQN LYKKELY | |||
Physicochemical properties | |||
Number of amino acids: | 247 | ||
Molecular weight: | 29,346.266 | ||
Theoretical pI: | 6.269 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20400 20650 | ||
Instability index: | 49.648 | ||
aromaticity | 0.105 | ||
GRAVY | -0.515 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.130 | ||
sheet | 0.308 |