| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340317.1 | 5prime_partial | 189 | 1-570(+) |
Amino Acid sequence : | |||
| RRNFCKMDAANVHNYRRHITSFEIFPCNERYEDDELWAVKIKGSAFLWHQIRCMVAVLFLIGQGLESSEVIDELLDTENTPKKPQYKMAPEIPLVLRSCEFDGLRFTCSSDARQALRNHL QKECRNYKLQAAIFHEALMSSSCTLYDYSQLNSRAKKKEPAHIPLMSRPTEPSYEERRAKMAGGRRRSG* | |||
Physicochemical properties | |||
| Number of amino acids: | 189 | ||
| Molecular weight: | 21,976.940 | ||
| Theoretical pI: | 8.973 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21805 | ||
| Instability index: | 89.066 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.631 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.206 | ||
| sheet | 0.286 | ||