| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340332.1 | internal | 254 | 1-762(+) |
Amino Acid sequence : | |||
| APRLAIASIGKLLFAHFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLIALCQAIDLRHLEE NLKHAVKNTLSQVAKRTLTMGANGELHPSRFCEKDLIRVVDREYVFAYIDDPCSATYPLMQKLRQVLVDHALKNGENEKNVGTSIFHKIEAFEEELKALLPKEVESARVALESGNPAVAN RIAECRSYPLYKFI | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 28,251.950 | ||
| Theoretical pI: | 6.272 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13410 13660 | ||
| Instability index: | 34.531 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.174 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.232 | ||
| sheet | 0.319 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340332.1 | internal | 254 | 1-762(+) |
Amino Acid sequence : | |||
| APRLAIASIGKLLFAHFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTYLIALCQAIDLRHLEE NLKHAVKNTLSQVAKRTLTMGANGELHPSRFCEKDLIRVVDREYVFAYIDDPCSATYPLMQKLRQVLVDHALKNGENEKNVGTSIFHKIEAFEEELKALLPKEVESARVALESGNPAVAN RIAECRSYPLYKFI | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 28,251.950 | ||
| Theoretical pI: | 6.272 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13410 13660 | ||
| Instability index: | 34.531 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.174 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.232 | ||
| sheet | 0.319 | ||