| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340349.1 | 3prime_partial | 124 | 373-2(-) |
Amino Acid sequence : | |||
| MTNYVVLRFGDLKPDPNGLGSSLGGNDCCYMVVFQYGSIVLFNVRDHEIDGYLKIVERHASGLLPEMRKDEYEVRENPSLHTWMQGGLDYIMLQYLNTDGIRTIGSVLGQSIALDYYVRQ VDGM | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 14,057.864 | ||
| Theoretical pI: | 4.835 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19035 | ||
| Instability index: | 19.173 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.169 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.250 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340349.1 | 3prime_partial | 124 | 373-2(-) |
Amino Acid sequence : | |||
| MTNYVVLRFGDLKPDPNGLGSSLGGNDCCYMVVFQYGSIVLFNVRDHEIDGYLKIVERHASGLLPEMRKDEYEVRENPSLHTWMQGGLDYIMLQYLNTDGIRTIGSVLGQSIALDYYVRQ VDGM | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 14,057.864 | ||
| Theoretical pI: | 4.835 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19035 | ||
| Instability index: | 19.173 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.169 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.250 | ||
| sheet | 0.226 | ||