| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340352.1 | 3prime_partial | 108 | 40-363(+) |
Amino Acid sequence : | |||
| MLDTVCPELQVVNKTEHPISLKEDSTVVLTPDQDKEASPSLLPINFTGLSEAVKTGDTIFIGQYLFTGSDTTSSWLEVFVVKGKDAVCLVKNSATLAGSLLTLHVSQI | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 11,594.117 | ||
| Theoretical pI: | 4.604 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 26.627 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.182 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.231 | ||
| sheet | 0.241 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340352.1 | 3prime_partial | 108 | 40-363(+) |
Amino Acid sequence : | |||
| MLDTVCPELQVVNKTEHPISLKEDSTVVLTPDQDKEASPSLLPINFTGLSEAVKTGDTIFIGQYLFTGSDTTSSWLEVFVVKGKDAVCLVKNSATLAGSLLTLHVSQI | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 11,594.117 | ||
| Theoretical pI: | 4.604 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 26.627 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.182 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.231 | ||
| sheet | 0.241 | ||