| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340367.1 | 3prime_partial | 247 | 68-808(+) |
Amino Acid sequence : | |||
| MEGEEGVQQPQLVLAHNLFLLTQNDVDDIEKVRLRDEVFNFIVANDMAPLYETLVANKVLDLDQKALDSMRSKIDEELKKLEEKIADAEENLGESEVREAHLAKSLFYIRIGDKEKALEQ LKITESKTVAIGQKMDLVFYTLQIGFFHLDFDLISKSIDKAKNLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAATLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDA PEILTVI | |||
Physicochemical properties | |||
| Number of amino acids: | 247 | ||
| Molecular weight: | 28,439.291 | ||
| Theoretical pI: | 4.816 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17420 | ||
| Instability index: | 36.247 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.178 | ||
Secondary Structure Fraction | |||
| Helix | 0.364 | ||
| turn | 0.142 | ||
| sheet | 0.308 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340367.1 | 3prime_partial | 247 | 68-808(+) |
Amino Acid sequence : | |||
| MEGEEGVQQPQLVLAHNLFLLTQNDVDDIEKVRLRDEVFNFIVANDMAPLYETLVANKVLDLDQKALDSMRSKIDEELKKLEEKIADAEENLGESEVREAHLAKSLFYIRIGDKEKALEQ LKITESKTVAIGQKMDLVFYTLQIGFFHLDFDLISKSIDKAKNLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAATLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDA PEILTVI | |||
Physicochemical properties | |||
| Number of amino acids: | 247 | ||
| Molecular weight: | 28,439.291 | ||
| Theoretical pI: | 4.816 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17420 | ||
| Instability index: | 36.247 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.178 | ||
Secondary Structure Fraction | |||
| Helix | 0.364 | ||
| turn | 0.142 | ||
| sheet | 0.308 | ||