| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340395.1 | internal | 133 | 400-2(-) |
Amino Acid sequence : | |||
| NVRHHKVGESDEPSMYRIKDDLVYYVEVYEWSGTSWEPYVADDLQVHFYMMSPYVLKTLLNNQKGLYHTTFKVPDVYGVFQFKVEYKRLGYTSLSVAKQIPVRPFRHNEYERFIPASLSI LRSIIFNDVWFVH | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 15,919.976 | ||
| Theoretical pI: | 7.196 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34380 | ||
| Instability index: | 39.234 | ||
| aromaticity | 0.173 | ||
| GRAVY | -0.325 | ||
Secondary Structure Fraction | |||
| Helix | 0.414 | ||
| turn | 0.203 | ||
| sheet | 0.180 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340395.1 | internal | 133 | 400-2(-) |
Amino Acid sequence : | |||
| NVRHHKVGESDEPSMYRIKDDLVYYVEVYEWSGTSWEPYVADDLQVHFYMMSPYVLKTLLNNQKGLYHTTFKVPDVYGVFQFKVEYKRLGYTSLSVAKQIPVRPFRHNEYERFIPASLSI LRSIIFNDVWFVH | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 15,919.976 | ||
| Theoretical pI: | 7.196 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34380 | ||
| Instability index: | 39.234 | ||
| aromaticity | 0.173 | ||
| GRAVY | -0.325 | ||
Secondary Structure Fraction | |||
| Helix | 0.414 | ||
| turn | 0.203 | ||
| sheet | 0.180 | ||