Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340395.1 | internal | 133 | 400-2(-) |
Amino Acid sequence : | |||
NVRHHKVGESDEPSMYRIKDDLVYYVEVYEWSGTSWEPYVADDLQVHFYMMSPYVLKTLLNNQKGLYHTTFKVPDVYGVFQFKVEYKRLGYTSLSVAKQIPVRPFRHNEYERFIPASLSI LRSIIFNDVWFVH | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 15,919.976 | ||
Theoretical pI: | 7.196 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34380 | ||
Instability index: | 39.234 | ||
aromaticity | 0.173 | ||
GRAVY | -0.325 | ||
Secondary Structure Fraction | |||
Helix | 0.414 | ||
turn | 0.203 | ||
sheet | 0.180 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340395.1 | internal | 133 | 400-2(-) |
Amino Acid sequence : | |||
NVRHHKVGESDEPSMYRIKDDLVYYVEVYEWSGTSWEPYVADDLQVHFYMMSPYVLKTLLNNQKGLYHTTFKVPDVYGVFQFKVEYKRLGYTSLSVAKQIPVRPFRHNEYERFIPASLSI LRSIIFNDVWFVH | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 15,919.976 | ||
Theoretical pI: | 7.196 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34380 | ||
Instability index: | 39.234 | ||
aromaticity | 0.173 | ||
GRAVY | -0.325 | ||
Secondary Structure Fraction | |||
Helix | 0.414 | ||
turn | 0.203 | ||
sheet | 0.180 |