| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340397.1 | internal | 142 | 428-3(-) |
Amino Acid sequence : | |||
| YGTNNETPHSVCYGSTDDPATDLLELPTLQARYIYVDGDGTVPMESATADGLRAVARVGTAGDHRGILCDRQVFRIIRHWLRADHDPFYYPMIDYVILPTASEMESIKTKGGTEVTSLRE EREIVEDDAQACKAPTTEALVG | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 15,662.280 | ||
| Theoretical pI: | 4.629 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
| Instability index: | 37.330 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.385 | ||
Secondary Structure Fraction | |||
| Helix | 0.268 | ||
| turn | 0.190 | ||
| sheet | 0.261 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340397.1 | internal | 142 | 428-3(-) |
Amino Acid sequence : | |||
| YGTNNETPHSVCYGSTDDPATDLLELPTLQARYIYVDGDGTVPMESATADGLRAVARVGTAGDHRGILCDRQVFRIIRHWLRADHDPFYYPMIDYVILPTASEMESIKTKGGTEVTSLRE EREIVEDDAQACKAPTTEALVG | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 15,662.280 | ||
| Theoretical pI: | 4.629 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
| Instability index: | 37.330 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.385 | ||
Secondary Structure Fraction | |||
| Helix | 0.268 | ||
| turn | 0.190 | ||
| sheet | 0.261 | ||