| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340398.1 | 3prime_partial | 158 | 2-475(+) |
Amino Acid sequence : | |||
| MGMDECSRNTFHFLDNLITERRNLRIEGLDGLLLLILQAGERLLQLGLDLLPALRQLLLHLHLRLLLHLVERRRDLRPGRLHDRRSLLLQLLHLRRGVLDAVELLPDGGVSLVHELPERA VVELVHGEHEEQELDGDDGESEVEVQEGGLLNLHGEGG | |||
Physicochemical properties | |||
| Number of amino acids: | 158 | ||
| Molecular weight: | 16,749.250 | ||
| Theoretical pI: | 5.015 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 37.178 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.206 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.139 | ||
| sheet | 0.424 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340398.1 | 5prime_partial | 151 | 475-20(-) |
Amino Acid sequence : | |||
| PSLAVEIEKAALLDFNLTLPIIAVEFLLLMFAMDKLYYSPLGKFMDERDAAIREKLNSVKDTSTEVKQLEEQGSAVMKAARAEISAALNKMKKETQVEVEQKLAEGRKKIEAELQEALAS LENQKEETIKALDSQIAALSDEIVKKVKGVP* | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 16,749.250 | ||
| Theoretical pI: | 5.015 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 37.178 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.206 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.139 | ||
| sheet | 0.424 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340398.1 | 3prime_partial | 158 | 2-475(+) |
Amino Acid sequence : | |||
| MGMDECSRNTFHFLDNLITERRNLRIEGLDGLLLLILQAGERLLQLGLDLLPALRQLLLHLHLRLLLHLVERRRDLRPGRLHDRRSLLLQLLHLRRGVLDAVELLPDGGVSLVHELPERA VVELVHGEHEEQELDGDDGESEVEVQEGGLLNLHGEGG | |||
Physicochemical properties | |||
| Number of amino acids: | 158 | ||
| Molecular weight: | 16,749.250 | ||
| Theoretical pI: | 5.015 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 37.178 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.206 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.139 | ||
| sheet | 0.424 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY340398.1 | 5prime_partial | 151 | 475-20(-) |
Amino Acid sequence : | |||
| PSLAVEIEKAALLDFNLTLPIIAVEFLLLMFAMDKLYYSPLGKFMDERDAAIREKLNSVKDTSTEVKQLEEQGSAVMKAARAEISAALNKMKKETQVEVEQKLAEGRKKIEAELQEALAS LENQKEETIKALDSQIAALSDEIVKKVKGVP* | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 16,749.250 | ||
| Theoretical pI: | 5.015 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 37.178 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.206 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.139 | ||
| sheet | 0.424 | ||