Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340406.1 | 5prime_partial | 147 | 621-178(-) |
Amino Acid sequence : | |||
HEGATVAKKILHFFKEMATTSVEEGQVIGCHSEDQWKEQFEKGTASGKLVVVDFTASWCGPCRFIAPILAEFAKKMPHVIFLKVDVDELKKVAEDYKIEAMPTFLFFKGGELVDKVVGAR KEELQNTITKHAATVSAAATASATASA* | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 13,818.778 | ||
Theoretical pI: | 7.893 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 42.182 | ||
aromaticity | 0.108 | ||
GRAVY | -0.092 | ||
Secondary Structure Fraction | |||
Helix | 0.358 | ||
turn | 0.250 | ||
sheet | 0.300 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY340406.1 | complete | 120 | 229-591(+) |
Amino Acid sequence : | |||
MFGNGVLELFLPGTHNLVHQLSPLEEQEGRHCLNFVVLRHFLKLINVHLQEYNVGHLLGELCQNWCNETARPAPRSREVHHHQFPGRGALFKLFFPLVFGVAANHLSLFNRSSSHFLEKM * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 13,818.778 | ||
Theoretical pI: | 7.893 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 42.182 | ||
aromaticity | 0.108 | ||
GRAVY | -0.092 | ||
Secondary Structure Fraction | |||
Helix | 0.358 | ||
turn | 0.250 | ||
sheet | 0.300 |